Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G22810-AT4G14740
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Plant protein of unknown function (DUF828) with plant pleckstrin homology-like region
Function (paralog2):Plant protein of unknown function (DUF828) with plant pleckstrin homology-like region

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:0.37923144053927
Log2 mRNA fold difference:0.64495307943803
Log2 TE fold difference:-0.31866491100986
Sequences
Protein sequence

MEKPVFAPWRSDQVFRPPETPLEPMEFLSRSWSVSAHEVSKALTPSQQLLSKASIENTTV
ILEEPIAAGETETEDNSFVSGNPFSFACSETSQMVMDRILSQSQEVSPRTSGRLSHSSGP
LNGSLTDSPPISPHQVDDIKQFCRSNNNFNSQYRSTGTTPGPITATTTQSKTVGRWLKDR
REKKKEEMRAHNAQIHAAVSVAGVAAAVAAIAAATAASSSAGKDENMAKTDMAVASAATL
VAAQCVEAAEVMGAERDHLASVVSSAVNVRSAGDIMTLTAGAATALRGVATLKARAMKEV
WHIASVIPMDKGINLGGCSNVNGNGSYVSSSSSHSGEFLVEDNFLGHCNREWLARGGQLL
KRTRKGDLHWKIVSVYINRLNQVILKMKSRHVGGTFTKKNKNVVIDVIKNVQAWPGRHLL
EGGEDLRYFGLKTVPRGIVEFQCKSQREYEMWTQGVSRLIAVAAERNNRYRI

MEKLMVPTWRPDPVYRPPETPLEPMEFLARSWSVSALEVSKALTPPNPQILLSKTEEEEE
EEPISSVVDGDGDTEDTGLVTGNPFSFACSETSQMVMDRILSHSQEVSPRTSGRLSHSSG
PLNGSLTDSPPVSPPESDDIKQFCRANKNSLNSVNSQFRSTAATPGPITATATQSKTVGR
WLKDRREKKKEETRAHNAQIHAAVSVAGVAAAVAAIAAATAASSSCGKDEQMAKTDMAVA
SAATLVAAQCVEAAEVMGAEREYLASVVSSAVNVRSAGDIMTLTAGAATALRGVQTLKAR
AMKEVWNIASVIPMDKGLTSTGGSSNNVNGSNGSSSSSHSGELVQQENFLGTCSREWLAR
GCELLKRTRKGDLHWKIVSVYINKMNQVMLKMKSRHVGGTFTKKKKNIVLDVIKNVPAWP
GRHLLEGGDDLRYFGLKTVMRGDVEFEVKSQREYEMWTQGVSRLLVLAAERKFRM

www.000webhost.com

Other information
Ka divergence:-0.159382KaKs divergence:0.195253
GC content 1 (%):47GC content 2 (%):48GC content divergence:0.011
Length 1 (bp):1419Length 2 (bp):1428Length divergence:0.003
MFE 1 (kcal):-480.98MFE 2 (kcal):-453.76MFE divergence-0.029