Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G22840-AT4G14690
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Chlorophyll A-B binding family protein
Function (paralog2):Chlorophyll A-B binding family protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-0.62596683390063
Log2 mRNA fold difference:-3.2287448500801
Log2 TE fold difference:2.7100494590872
Sequences
Protein sequence

MATASFNMQSVFAGGLTTRKINTNKLFSAGSFPNLKRNYPVGVRCMAEGGPTNEDSSPAP
STSAAQPLPKSPSPPPPMKPKVSTKFSDLLAFSGPAPERINGRLAMVGFVAALAVELSKG
ENVLAQISDGGVSWFLGTTAILTLASLVPLFKGISVESKSKGIMTSDAELWNGRFAMLGL
VALAFTEFVKGGTLV

MATASFNMQSVFAAPSGVLTTRNIRNTNQLFFKRIAPVGVRCMAQGDPIKEDPSVPSTST
SATPPQMPQSPPPPVSKPKVSTKFGDLLAFSGPAPERINGRLAMVGFVAAIAMELSKGEN
VFAQISDGGVGWFLGTTALLTLASMVPLFKGIRAEAKSKGFMTSDAELWNGRFAMLGLVA
LAFTEYVTGGTLV

www.000webhost.com

Other information
Ka divergence:0.401495KaKs divergence:0.561003
GC content 1 (%):52GC content 2 (%):52GC content divergence:0
Length 1 (bp):588Length 2 (bp):582Length divergence:-0.005
MFE 1 (kcal):-202.53MFE 2 (kcal):-197.4MFE divergence-0.013