Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G22890-AT4G14680
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):ATP sulfurylase 1
Function (paralog2):Pseudouridine synthase/archaeosine transglycosylase-like family protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-3.7614052390761
Log2 mRNA fold difference:-3.8534366128094
Log2 TE fold difference:0.16297198523492
Sequences
Protein sequence

MASMAAVLSKTPFLSQPLTKSSPNSDLPFAAVSFPSKSLRRRVGSIRAGLIAPDGGKLVE
LIVEEPKRREKKHEAADLPRVELTAIDLQWMHVLSEGWASPLGGFMRESEFLQTLHFNSL
RLDDGSVVNMSVPIVLAIDDEQKARIGESTRVALFNSDGNPVAILSDIEIYKHPKEERIA
RTWGTTAPGLPYVDEAITNAGNWLIGGDLEVLEPVKYNDGLDRFRLSPAELRKELEKRNA
DAVFAFQLRNPVHNGHALLMTDTRRRLLEMGYKNPILLLHPLGGFTKADDVPLDWRMKQH
EKVLEDGVLDPETTVVSIFPSPMHYAGPTEVQWHAKARINAGANFYIVGRDPAGMGHPVE
KRDLYDADHGKKVLSMAPGLERLNILPFRVAAYDKTQGKMAFFDPSRPQDFLFISGTKMR
TLAKNNENPPDGFMCPGGWKVLVDYYESLTPAGNGRLPEVVPV

MASMSTVFPKPTSFISQPLTKSHKSDSVTTSISFPSNSKTRSLRTISVRAGLIEPDGGKL
VDLVVPEPRRREKKHEAADLPRVRLTAIDLQWMHVLSEGWASPLRGFMRESEFLQTLHFN
LLNLDDGSVVNMSVPIVLAIDDQQKALIGESKRVSLVDSDDNPIAILNDIEIYKHPKEER
IARTWGTTAPGLPYVEEAITNAGDWLIGGDLEVLEPVKYNDGLDRFRLSPFELRKELEKR
GADAVFAFQLRNPVHNGHALLMTDTRRRLLEMGYKNPILLLHPLGGFTKADDVPLSWRMK
QHEKVLEDGVLDPETTVVSIFPSPMLYAGPTEVQWHAKARINAGANFYIVGRDPAGMGHP
VEKRDLYDADHGKKVLSMAPGLERLNILPFRVAAYDKTQGKMAFFDPSRAQDFLFISGTK
MRALAKNRENPPDGFMCPGGWKVLVDYYDSLTLTGNTKLPEKIPV

www.000webhost.com

Other information
Ka divergence:-0.0344046KaKs divergence:0.212609
GC content 1 (%):48GC content 2 (%):45GC content divergence:-0.032
Length 1 (bp):1392Length 2 (bp):1398Length divergence:0.002
MFE 1 (kcal):-469.5MFE 2 (kcal):-438.4MFE divergence-0.034