Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G22900-AT4G14660
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):RNA polymerase Rpb7-like, N-terminal domain
Function (paralog2):RNA polymerase Rpb7-like, N-terminal domain

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:2.2643774715546
Log2 mRNA fold difference:0.34947793140588
Log2 TE fold difference:2.0677825769559
Sequences
Protein sequence

MFIKVKLPWDVTIPAEDMDTGLMLQRAIVIRLLEAFSKEKATKDLGYLITPTILENIGEG
KIKEQTGEIQFPVVFNGICFKMFKGEIVHGVVHKVHKTGVFLKSGPYEIIYLSHMKMPGY
EFIPGENPFFMNQYMSRIQIGARVRFVVLDTEWREAEKDFMALASIDGDNLGPF

MFLKVQLPWNVMIPAENMDAKGLMLKRAILVELLEAFASKKATKELGYYVAVTTLDKIGE
GKIREHTGEVLFPVMFSGMTFKIFKGEIIHGVVHKVLKHGVFMRCGPIENVYLSYTKMPD
YKYIPGENPIFMNEKTSRIQVETTVRVVVIGIKWMEVEREFQALASLEGDYLGPLSEE

www.000webhost.com

Other information
Ka divergence:-0.473854KaKs divergence:-0.0607477
GC content 1 (%):43GC content 2 (%):45GC content divergence:0.023
Length 1 (bp):525Length 2 (bp):537Length divergence:0.011
MFE 1 (kcal):-144.3MFE 2 (kcal):-156.19MFE divergence0.04