Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G22970-AT4G14620
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Protein of unknown function (DUF506)
Function (paralog2):Protein of unknown function (DUF506)

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-2.9878008905075
Log2 mRNA fold difference:-3.1283522690539
Log2 TE fold difference:0.072372677608181
Sequences
Protein sequence

MPFTMKIQPIDIDSSPTVARAESGNKPVLKSRLKRLFDRPFTNVLRNSTTTTTEKPFVVT
GGEVQCGGVVTEFEPSSVCLAKMVQNFIEENNEKQAKCGRNRCNCFNGNNDGSSDDESDL
FGGSIDGCDASDHLKSLIPCTTVGERNLLADAAKIVDKNKSVKRKDDMKKIVNEGLLSLN
YNSSICKSKWDKSPSFPAGEYEYIDVIIGEERLIIDVDFRSEFDIARQTSGYKVLLQSLP
FIFVGKSDRLSQIVFLISEAAKQSLKKKGMPFPPWRKAEYMRSKWLSSYTRASVVVVDET
VTVTDVTAADAAVEKEVDSVEIELVFEEKCLSPRVIVNSSSSPTDGDDDVAVEREVKAVT
GLASLFKEKP

MMKIQPINNDLPANRVESSTKPVLKSRLKRLLDRPFTRISNSEKLLISGDGVVAGTEFEP
SLAKMVQNYMEENNDKQTKNGRNTHRCNCFNGNNDISDDELDFFDYDNFKSLIQCGSFVE
KSLLVEATKIIEKNKSVKRKDELRKIVVDELSSLGYDSSICKSKWDKTRSIPAGEYEYID
VIVNGERLIIDIDFRSEFEIARQTSGYKELLQSLPLIFVGKSDRIRQIVSIVSEASKQSL
KKKGMHFPPWRKADYMRAKWLSSYTRNSGEKKPTVTSAAKVVAEPELDSSEIELIFEEKV
LLPPLKSPITSVGRDDDDVAESVKKEAKVVTGLALLFKENH

www.000webhost.com

Other information
Ka divergence:0.263194KaKs divergence:-0.323747
GC content 1 (%):44GC content 2 (%):42GC content divergence:-0.023
Length 1 (bp):1113Length 2 (bp):1026Length divergence:-0.041
MFE 1 (kcal):-354.41MFE 2 (kcal):-290.97MFE divergence-0.098