Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G23000-AT4G14580
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):CBL-interacting protein kinase 7
Function (paralog2):CBL-interacting protein kinase 4

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:-5.1159740476593
Log2 mRNA fold difference:-6.0060233063988
Log2 TE fold difference:1.2654197405075
Sequences
Protein sequence

MESLPQPQNQSSPATTPAKILLGKYELGRRLGSGSFAKVHLARSIESDELVAVKIIEKKK
TIESGMEPRIIREIDAMRRLRHHPNILKIHEVMATKSKIYLVMELASGGELFSKVLRRGR
LPESTARRYFQQLASALRFSHQDGVAHRDVKPQNLLLDEQGNLKVSDFGLSALPEHLQNG
LLHTACGTPAYTAPEVISRRGYDGAKADAWSCGVILFVLLVGDVPFDDSNIAAMYRKIHR
RDYRFPSWISKQAKSIIYQMLDPNPVTRMSIETVMKTNWFKKSLETSEFHRNVFDSEVEM
KSSVNSITAFDLISLSSGLDLSGLFEAKKKKERRFTAKVSGVEVEEKAKMIGEKLGYVVK
KKMMKKEGEVKVVGLGRGRTVIVVEAVELTVDVVVVEVKVVEGEEDDSRWSDLITELEDI
VLSWHNDIM

MESPYPKSPEKITGTVLLGKYELGRRLGSGSFAKVHVARSISTGELVAIKIIDKQKTIDS
GMEPRIIREIEAMRRLHNHPNVLKIHEVMATKSKIYLVVEYAAGGELFTKLIRFGRLNES
AARRYFQQLASALSFCHRDGIAHRDVKPQNLLLDKQGNLKVSDFGLSALPEHRSNNGLLH
TACGTPAYTAPEVIAQRGYDGAKADAWSCGVFLFVLLAGYVPFDDANIVAMYRKIHKRDY
RFPSWISKPARSIIYKLLDPNPETRMSIEAVMGTVWFQKSLEISEFQSSVFELDRFLEKE
AKSSNAITAFDLISLSSGLDLSGLFERRKRKEKRFTARVSAERVVEKAGMIGEKLGFRVE
KKEETKVVGLGKGRTAVVVEVVEFAEGLVVADVKVVVEGEEEEEEVESHWSELIVELEEI
VLSWHN

www.000webhost.com

Other information
Ka divergence:-0.0162811KaKs divergence:0.563906
GC content 1 (%):44GC content 2 (%):49GC content divergence:0.054
Length 1 (bp):1290Length 2 (bp):1281Length divergence:-0.004
MFE 1 (kcal):-407.14MFE 2 (kcal):-451.61MFE divergence0.052