Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G23050-AT4G14550
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):indole-3-acetic acid 7
Function (paralog2):indole-3-acetic acid inducible 14

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-2.9049536419494
Log2 mRNA fold difference:-2.7582378206372
Log2 TE fold difference:-0.080220657434018
Sequences
Protein sequence

MIGQLMNLKATELCLGLPGGAEAVESPAKSAVGSKRGFSETVDLMLNLQSNKEGSVDLKN
VSAVPKEKTTLKDPSKPPAKAQVVGWPPVRNYRKNMMTQQKTSSGAEEASSEKAGNFGGG
AAGAGLVKVSMDGAPYLRKVDLKMYKSYQDLSDALAKMFSSFTMGNYGAQGMIDFMNESK
LMNLLNSSEYVPSYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGSEAVGLAPRAMEKYCK
NRS

MNLKETELCLGLPGGTETVESPAKSGVGNKRGFSETVDLKLNLQSNKQGHVDLNTNGAPK
EKTFLKDPSKPPAKAQVVGWPPVRNYRKNVMANQKSGEAEEAMSSGGGTVAFVKVSMDGA
PYLRKVDLKMYTSYKDLSDALAKMFSSFTMGSYGAQGMIDFMNESKVMDLLNSSEYVPSY
EDKDGDWMLVGDVPWPMFVESCKRLRIMKGSEAIGLAPRAMEKFKNRS

www.000webhost.com

Other information
Ka divergence:-0.085943KaKs divergence:-0.0741385
GC content 1 (%):50GC content 2 (%):48GC content divergence:-0.02
Length 1 (bp):732Length 2 (bp):687Length divergence:-0.032
MFE 1 (kcal):-243.08MFE 2 (kcal):-223.6MFE divergence-0.042