Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G23070-AT4G14510
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):CRM family member 3A
Function (paralog2):CRM family member 3B

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-0.99440631392034
Log2 mRNA fold difference:-0.7535879856263
Log2 TE fold difference:-0.25447890189623
Sequences
Protein sequence

MAMKPSLHFCPTTVTKKFVYSFQSSFCFRFLRYSSSISLGSCKGVTFSSRNDQIASRRFS
FSRDCNNGVWLENWNRIQKRNQPKPPKVVVNYRKEGRFSGSEIVSGDDNRSRDGDGSTME
KIVEKLKKYGYMEEVQNKEIEQERRIEKGSVEDIFYVEEGKLPNTRGGFTEESLLGGENV
IGSNGDVGFPWEKMSAKEKKELEAEWTAKKENRYSLAEMTLPESELRRLRNLTFRTASKM
RIRGGGVTQVAVDAIKEKWKSAEIVRLKIEGASALNMRKMHEILEKKTGGLVIWRSGTSI
SLYRGVSYELPSGKWNKQRREETPPEAVIENHDETTTMVDKSDEKVHLPQLEQETTSVEK
KDQTSPVVEYEDELDELLDDLGPRFMDWPGDNPLPVDADLLPGAIPDYEPPFRVLPYGVR
SSLGPKEATALRRLARSIPPHFALGRSRQLQGLATAMVRLWEKSMLAKIAIKRGVQSTTS
ERMAEDLKKLTGGIMLSRNKDFLVFYRGKNFLSREVADALVEQERFVRTLQDEEEQARLR
GSSALIVPSTEPANKLVSAGTLGETLDATGKWGKNLDDDDHSDEVKQEVEILRHENLVRK
LERKLAFAERKLLKAERGLAKVEVCLKPAEQREDPESITDEERFMFRKLGLKMKAFLLLG
RRGVFDGTVENMHLHWKYRELVKIIVKAKTFDGVKKVALALEAESGGILVSIDKVTKGYA
IIVYRGQDYKRPTMLRPKNLLTKRKALARSIELQRREGLLKHISTMQAKAKQLRAEIEQM
EKVTDKGDEELYNKLDMAYASSDEETDEEDDDDAFPETYAEGEDGEEGEILAGELSETED
KDLDSNESETGFGDDSVLFAEDLHTKSEDLPNKKVRLQHQS

MAINSSHHFCPMTTTTTTSAKFVDSLGSSFCKFHGTSSSISLRSYRFGFSFMKNVKRLSC
EGSSSSSSSRNENWNRTQKQNQFRPSKVVLNRRKDERFSDLGVISGENSSRSGDVGGGSG
SSSTMEKIVEKLKKYGFVDEDQFQDKEVEQERRIEKSSVEERFYVEERRGGFSEESPFGV
YGGNDEVKFPWEKVSSMEKKELVNGEWTAKKESRYSLAEMTLSEFELNRLRNVMFRTKSK
MRVTGAGVTQAVVDAIQEKWKGSEIVRLKIEGSSALNMRRMHEILERKTGGLVIWRSGTS
IALYNYKGGSNRDGSGNMNKQVYRRAERLPSSLPTSTVDQSVQLVNLPQLEKEPTVVGNK
DRTSPQEVEYEDEINELLEGLGPRYTDWQGGYPLPVDADLLPGIVPGYEPPFRALPYGVR
STLGTKEATSLRRIATVLPPHFALGRSRQLQGLATAMVKLWQKSLIAKVALKRGVQLTTS
ERMAEDIKRLTGGMLLSRNKDFLVFYRGKSFLSLEVGEALMEKEMLVRTLQDEEEQARLR
ASSALVVPSIKANQQLARTLQDKEEQARPSALVLPSTKANQNLVSAGTLGETLDATGKWG
KNLDNDDHVEEMKQEVEKVRSAKLVRKLERKLAFAEKKLLKAERALAKVEESLKPAEQRT
DLEGITEEERFMFQKLGLKMKAFLLLGRRGVFDGTVENMHLHWKYRELIKILVKAKTLEG
AQKVAMALEAESGGILVSVDKISKGYAVIVYRGKDYKRPTTLRPKNLLTKRKALARSLEL
QKREALIKHIEAIQTRSEQLRAEIEQVELVKDKGDETLYDKLDMAYSSDEETEETDGEED
DVYLDTYEDEGEDDEEGGIQANGSLSETDVEFGSDESDTDFGDNSASSTTPETTFVELQN
EELDVQP

www.000webhost.com

Other information
Ka divergence:0.144233KaKs divergence:-0.11347
GC content 1 (%):42GC content 2 (%):42GC content divergence:0
Length 1 (bp):2646Length 2 (bp):2724Length divergence:0.015
MFE 1 (kcal):-761.92MFE 2 (kcal):-768.01MFE divergence0.004