Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G23080-AT4G14500
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Polyketide cyclase/dehydrase and lipid transport superfamily protein
Function (paralog2):Polyketide cyclase/dehydrase and lipid transport superfamily protein

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:0.089951734083681
Log2 mRNA fold difference:0.23751150343281
Log2 TE fold difference:-0.1574389611181
Sequences
Protein sequence

MDIFMDFFNKPSVTETFVDVLLCAVPIWVTVMIGLLIGWSWRPRWTSLVYLGFRSKLRFL
CTVPPGFGARRIWLAFTALSAFSVCSTSNKSSVNNGSSKPVEEEAFSRASDKVTEKEKDV
VTEKDLEHLLHLLEAGNASFEWQSMMDKSTPNMSYQAWRHEPEIGPVVYRSRTVFEDVTP
DIVRDFFWDDEFRPKWDTMLAYFKTLEEDPKTGTTIVHWIKKFPFFCSDREYIIGRRIWE
SGRKYYAVTKGVPYKALSKRDKPRRVELYFSSWIINAVESRKGDGQMTACEVSLVHYEDM
GIPKDVAKLGVRHGMWGAVKKLNSGLRAYQSARKPGTSLSRSAQMASITTKLNMDLVETS
GAEDEERGRAVENARKQNDQFGVDWKWIVVGGVALACGLHSSAIGKALMVGAGQRLARR

MDETYFDLLNFFKNPSFTETFVDILLCAVPIWLAVMIGLLIGWSWRPRWTGLIYLGFRSK
LRFLWTAPPGFGARRLWLAFTALSAFSVCRTIWSRNDTRANKSATGSASSQTPVEDNDES
GLASRGSDNGTVTEDIVTENDLEHLLQLLEVGNAALEWQSMMDKTTPNMSYQAWRHEPET
GPVIYRSRTVFEDATPDIVRDFFWDDEFRPKWDFMLANFKTLEEDTQTGTMIVQWRKKFP
FFCSDREYIIGRRIWESGKKYYCVTKGVPYPALPKRDKPRRVELYFSSWVIRAVESRKGD
GQQTACEVSLVHYEDMGIPKDVAKLGVRHGMWGAVKKLNSGLRAYQSARKSDSSLSRIAQ
MARITTKLNMDSAESSSRDEDRSRAMEYARQRDHLRMDWKWVVVGGVALACGLHSGIIGK
ALLAGAGQRLARR

www.000webhost.com

Other information
Ka divergence:-0.0784802KaKs divergence:0.0157708
GC content 1 (%):43GC content 2 (%):46GC content divergence:0.034
Length 1 (bp):1260Length 2 (bp):1302Length divergence:0.016
MFE 1 (kcal):-378.76MFE 2 (kcal):-419.16MFE divergence0.051