Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G23180-AT4G14420
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):HR-like lesion-inducing protein-related
Function (paralog2):HR-like lesion-inducing protein-related

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:2.4489920517129
Log2 mRNA fold difference:3.5534589499745
Log2 TE fold difference:-1.094905343523
Sequences
Protein sequence

MDVVQRKVKKIGRKVASFPHVETIGRALFASSFFLSSWHDYMELKANWNGTEDYWSPKFG
YSGDQIKHLMTVSIIVRTLGGLIFIYGSFFGAFLLLMYQGIATMVHHDFYNHRLDTEEFG
LLYLKLKRILNETVSYNTAYNLYKSDFDEQQIEQVKSKFRELADHAMTNPALFGHNEFLR
RLLSFVKGLAVVGALLFFVDMKYRLNKAKKQSKVKND

MELASFLGRALFVSVFLLSAWQEFNDFGEDGGRSAKSLKPKFNAFVNHVTTHTGQQLPPV
DMKILVAAAIALKGIGGLLFVFGSSLGAYLLLLHQAVATPILYDFYNYDVDRKEFGQLFS
KFTQSLALLGGLLFFIGMKNSRKHGRQLRKKAPKAKAN

www.000webhost.com

Other information
Ka divergence:-0.68188KaKs divergence:-0.354945
GC content 1 (%):40GC content 2 (%):43GC content divergence:0.036
Length 1 (bp):654Length 2 (bp):477Length divergence:-0.156
MFE 1 (kcal):-174.01MFE 2 (kcal):-133.7MFE divergence-0.131