Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G23210-AT4G14410
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):basic helix-loop-helix (bHLH) DNA-binding superfamily protein
Function (paralog2):basic helix-loop-helix (bHLH) DNA-binding superfamily protein

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:-4.7212910541876
Log2 mRNA fold difference:1.0347261463759
Log2 TE fold difference:-5.7701848295443
Sequences
Protein sequence

MYPSIEDDDDLLAALCFDQSNGVEDPYGYMQTNEDNIFQDFGSCGVNLMQPQQEQFDSFN
GNLEQVCSSFRGGNNGVVYSSSIGSAQLDLAASFSGVLQQETHQVCGFRGQNDDSAVPHL
QQQQGQVFSGVVEINSSSSVGAVKEEFEEECSGKRRRTGSCSKPGTKACREKLRREKLND
KFMDLSSVLEPGRTPKTDKSAILDDAIRVVNQLRGEAHELQETNQKLLEEIKSLKADKNE
LREEKLVLKAEKEKMEQQLKSMVVPSPGFMPSQHPAAFHSHKMAVAYPYGYYPPNMPMWS
PLPPADRDTSRDLKNLPPVA

MYPSLDDDFVSDLFCFDQSNGAELDDYTQFGVNLQTDQEDTFPDFVSYGVNLQQEPDEVF
SIGASQLDLSSYNGVLSLEPEQVGQQDCEVVQEEEVEINSGSSGGAVKEEQEHLDDDCSR
KRARTGSCSRGGGTKACRERLRREKLNERFMDLSSVLEPGRTPKTDKPAILDDAIRILNQ
LRDEALKLEETNQKLLEEIKSLKAEKNELREEKLVLKADKEKTEQQLKSMTAPSSGFIPH
IPAAFNHNKMAVYPSYGYMPMWHYMPQSVRDTSRDQELRPPAA

www.000webhost.com

Other information
Ka divergence:-0.159047KaKs divergence:-0.288889
GC content 1 (%):43GC content 2 (%):43GC content divergence:0
Length 1 (bp):963Length 2 (bp):852Length divergence:-0.061
MFE 1 (kcal):-285.94MFE 2 (kcal):-250.69MFE divergence-0.066