Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G23280-AT4G14365
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):XB3 ortholog 5 in Arabidopsis thaliana
Function (paralog2):XB3 ortholog 4 in Arabidopsis thaliana

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-0.14010422700602
Log2 mRNA fold difference:0.80313810860901
Log2 TE fold difference:-0.94674937286737
Sequences
Protein sequence

MGQQQSKGELLYQQVSYGNSEGIRALHRDGGDLEWMDREGKTPLILACMNSELFDVAKTL
IELGSNVNAYRPGRHAGTPLHHAAKRGLENTVKLLLSHGANPLVLNDDCQTPLEVARVKG
FSNVVRAIEKHICLFSGWMREFYGPTFLDLFAPQLLSRRVWVVIVPTGSRNPTKPFKLEL
VVYASLQDAQPRTVMPLWKANLEEPKAKQSDTSVMIVDNSTIPSRRMKKRRVCASHGRRR
PQVVRQTRLKFAPSTEGDSQQLKWFCDACKGIPQPMHPPVFLQAPPSAPPPPSEDGLAMG
MNASLHTTMSDPSNLNHHSIGQASSSSGPSSSTAPPSGKASAFGFNSHGIGIVLESSPSA
PPLTDDDIATVDDGPIHYPSIDSTPVDLPSAASLPASTEGERKEDGNTGTCAICLDAPSE
AVCVPCGHVAGCMSCLKEIKSKNWGCPVCRAKIDQVIKLYRV

MGQQQSQSKDEMLFQEVSNNNVEGIKSLHHEGAGLEGVDKLGRTPLILACTNDDLYDVAK
TLLELGSNVNAYRSGCNGGTPLHHAAKRGLVHTVKLLLSHGANPLVLDDDVKTALEVARD
EGYSNVVRAIESHICLFSGCMREYSGSSLLNLFAPQLLSRKVWVVVVPTGSRNPTKPLKL
ELVLYDSIQDAQPRMVIPLWKANLEEPKSFRCDDSVMIIDDSRSPKSMRQRRESGFISQA
RRWAQVDRQIRLKLAAEIKGDMKQMNWFSEACKGVPQPMNPPRFMKTSQATTTTTNVPAL
SDDALTRVAMSLPSPKTANKEDGLCVICVDAPSEAVCVPCGHVAGCISCLKEIENKKMGC
PVCRANIDQVIKLYHV

www.000webhost.com

Other information
Ka divergence:0.550867KaKs divergence:0.523415
GC content 1 (%):46GC content 2 (%):43GC content divergence:-0.034
Length 1 (bp):1389Length 2 (bp):1131Length divergence:-0.102
MFE 1 (kcal):-426.1MFE 2 (kcal):-329.4MFE divergence-0.128