Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G23300-AT4G14360
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):S-adenosyl-L-methionine-dependent methyltransferases superfamily protein
Function (paralog2):S-adenosyl-L-methionine-dependent methyltransferases superfamily protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-0.35920263195915
Log2 mRNA fold difference:-0.15183215465293
Log2 TE fold difference:-0.15858587392426
Sequences
Protein sequence

MRGRSEGGKKKPVIVLLCVASVVLVFVYLFFGSSNHKAIEYGRKLGLGGDDDDSTKKDDT
SSSFYVEDVVGNGFTPRSFPVCDDRHSELIPCLDRNLIYQMRLKLDLSLMEHYERHCPPP
ERRFNCLIPPPPGYKIPIKWPKSRDEVWKVNIPHTHLAHEKSDQNWMVVKGEKINFPGGG
THFHYGADKYIASMANMLNFPNNVLNNGGRLRTFLDVGCGVASFGGYLLASEIMTMSLAP
NDVHQNQIQFALERGIPAYLGVLGTKRLPYPSRSFELAHCSRCRIDWLQRDGILLLELDR
VLRPGGYFAYSSPEAYAQDEEDLRIWREMSALVGRMCWTIAAKRNQTVIWQKPLTNDCYL
GREPGTQPPLCNSDSDPDAVYGVNMEACITQYSDHDHKTKGSGLAPWPARLTSPPPRLAD
FGYSTDIFEKDTETWRQRVDTYWDLLSPKIQSDTVRNIMDMKASMGSFAAALKEKDVWVM
NVVPEDGPNTLKLIYDRGLMGAVHSWCEAFSTYPRTYDLLHAWDIISDIKKRGCSAEDLL
LEMDRILRPSGFILIRDKQSVVDLVKKYLKALHWEAVETKTASESDQDSDNVILIVQKKL
WLTSESLRDLE

MKGRSDGGQKKRVIALVCVAAVVLVFVYLFYGSSDHRASAIEYGRKLGLGGDDDDTKQDD
TSSSFGVDDGFTPRSFPVCDDRHSELIPCLDRNLIYQMRLKLDLSLMEHYERHCPPPERR
FNCLIPPPNGYKVPIKWPKSRDEVWKVNIPHTHLAHEKSDQNWMVVKGDKINFPGGGTHF
HYGADKYIASMANMLNYPNNVLNNGGRLRTVFDVGCGVASFGGYLLSSDILTMSLAPNDV
HQNQIQFALERGIPASLGVLGTKRLPYPSRSFELSHCSRCRIDWLQRDGILLLELDRVLR
PGGYFAYSSPEAYAQDEEDLRIWREMSALVERMCWKIAAKRNQTVIWQKPLTNDCYLERE
PGTQPPLCRSDNDPDAVWGVNMEACITSYSDHDHKTKGSGLAPWPARLTSPPPRLADFGY
STGMFEKDTELWRQRVDTYWDLLSPRIESDTVRNIMDMKASMGSFAAALKEKDVWVMNVV
PEDGPNTLKLIYDRGLMGAVHSWCEAFSTYPRTYDLLHAWDIISDIKKKGCSEVDLLLEM
DRILRPSGFIIIRDKQRVVDFVKKYLKALHWEEVGTKTDSDSDQDSDNVVFIVQKKLWLT
SESLRDME

Other information
Ka divergence:-0.217835KaKs divergence:-0.349342
GC content 1 (%):43GC content 2 (%):43GC content divergence:0
Length 1 (bp):1836Length 2 (bp):1827Length divergence:-0.002
MFE 1 (kcal):-550.63MFE 2 (kcal):-548.07MFE divergence-0.002