Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G23310-AT4G14350
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):AGC (cAMP-dependent, cGMP-dependent and protein kinase C) kinase family protein
Function (paralog2):AGC (cAMP-dependent, cGMP-dependent and protein kinase C) kinase family protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-0.20358490796933
Log2 mRNA fold difference:-0.023060239959011
Log2 TE fold difference:-0.18100704521116
Sequences
Protein sequence

MDTARAWLKKLKSKGKEKSSNKKETSRGNVKEGSKTAGGEEAVSNVTKQKAAAAKQYIEN
HYKKQVQSQQQRKERRDMLENKLAAAEVSEEEQKNLLKDLEKKETEYMRRQRHKMGTDDF
EPLTMIGKGAFGEVRICREKTTGNVYAMKKLKKSEMLRRGQVEHVKAERNLLAEVDSNCI
VKLYCSFQDEEYLYLIMEYLPGGDMMTLLMRKDTLTEDEARFYVGETVLAIESIHKHNYI
HRDIKPDNLLLDRSGHMKLSDFGLCKPLDCSILQEKDFVVAHNLSGALQSDGRPVAPRRT
RSQMEQLQNWQRNRRMLAYSTVGTPDYIAPEVLLKKGYGMECDWWSLGAIMYEMLVGFPP
FYSDEPMTTCRKIVNWKNYLKFPDEVRLSPEAKDLICRLLCNVEQRIGTKGANEIKEHPW
FSGVEWEKLYQMKAAFIPQVNDELDTQNFEKFEETDKQVPKTPKSGPWRKMLSSKDINFV
GYTYKNVEIVNHDQLPGIAELKKKSTKPKRPSIKSLFEDESASSTTSHQGSFMKLLPTQI
EVPEKEDKSSSSSETLSSSTTRFDNATS

METAKAWLSKLKSKDKVKSSKKKEATSNVKEGPKTAGGEEALSNITKEKAAAAKLYIENH
YKMQMQSLQERKERRKMLEKKLAAAEVSEEEQNNLLKDLEMKETEYMRRQRHKMGADDFE
PLTMIGKGAFGEVRICREKGTGNVYAMKKLKKSEMLRRGQVEHVKAERNLLAEVDSNCIV
KLYCSFQDEEYLYLIMEYLPGGDMMTLLMRKDTLTEDEARFYIGETVLAIESIHKHNYIH
RDIKPDNLLLDKDGHMKLSDFGLCKPLDCSNLQEKDFTVARNVSGALQSDGRPVATRRTQ
QEQLLNWQRNRRMLAYSTVGTPDYIAPEVLLKKGYGMECDWWSLGAIMYEMLVGFPPFYS
DDPMTTCRKIVNWRNYLKFPDEVRLSPEAKDLICRLLCNVEQRLGTKGADEIKGHPWFRG
TEWGKLYQMKAAFIPQVNDELDTQNFEKFEETDKQVPKSAKSGPWRKMLSSKDINFVGYT
YKNVEIVNDDQIPGIAELKKKSNKPKRPSIKSLFEDETSGGTTTHQGSFLNLLPTQIEDP
EKEGSKSSSSG

www.000webhost.com

Other information
Ka divergence:-0.0313492KaKs divergence:0.205339
GC content 1 (%):40GC content 2 (%):41GC content divergence:0.012
Length 1 (bp):1707Length 2 (bp):1656Length divergence:-0.015
MFE 1 (kcal):-449.2MFE 2 (kcal):-436.34MFE divergence-0.015