Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G23340-AT4G14340
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):casein kinase I-like 10
Function (paralog2):casein kinase I

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:-2.1116214139056
Log2 mRNA fold difference:-0.4751266316319
Log2 TE fold difference:-1.7234737319192
Sequences
Protein sequence

MDHVIGGKFKLGRKIGSGSFGELYIGINVQTGEEVALKLEPVKTKHPQLHYESKVYMLLQ
GGTGVPHIKWFGVEGNYNCMAIDLLGPSLEDLFNYCTRSFSLKTVLMLADQLINRVEYMH
SRGFLHRDIKPDNFLMGLGRKANQVYIIDYGLAKKYRDLQTHKHIPYRENKNLTGTARYA
SVNTHLGIEQSRRDDLESLGYVLMYFIRGSLPWQGLKAGTKKQKYEKISEKKMLTPVEVL
CKSYPSEFTSYFHYCRSLRFEDKPDYSYLKRLFRDLFIREGYQFDYVFDWTILKYPQSGS
ISKPRPNPKPALDPPGPSAERNEKPIVGQDLRERFSGAVEAFARRNVPSHGIRPKHIFSD
DASKEVQVSEKTRNEIATKMAVMSSSQPGSSGELSENRSSKLFSSSAQKIQPVQETKLSA
RLGRDDGLRSFDMLTIGSGKRK

MDRNQKMDHVIGGKFKLGRKLGSGSFGELYLGINIQTGEEVAVKLEPVKTRHPQLQYESK
IYMFLQGGTGVPHLKWFGVEGEYSCMVIDLLGPSLEDLFNYCKRIFSLKSVLMLADQLIC
RVEYMHSRGFLHRDIKPDNFLMGLGRRANQVYIIDYGLAKKYKDLQTQKHIPYRENKNLT
GTARYASVNTHLGIEQSRRDDLESLGYVLMYFLRGSLPWQGLKAGTKKQKYDKISEKKML
TSVETLCKSYPSEFTSYFHYCRSLRFEDKPDYSYLRRLFRDLFIREGYQLDYVFDWTISK
YPQIGSSSRPRPTPRPALDPPGPPAERAEKPTVGQDLRGRFTGAIEAFTRRNVSSQGALG
DRSRHRSSDDIPSSAKEVHESRNGSTSKRGVISSTRPGSSAEPSENHSSRLFSSGSRHAT
TQRVPQSYESAAAARPGHEDAIRNFELLTIGSGKKRK

www.000webhost.com

Other information
Ka divergence:-0.035792KaKs divergence:0.159685
GC content 1 (%):41GC content 2 (%):43GC content divergence:0.024
Length 1 (bp):1329Length 2 (bp):1374Length divergence:0.017
MFE 1 (kcal):-370.05MFE 2 (kcal):-408.93MFE divergence0.05