Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G23390-AT4G14320
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Zinc-binding ribosomal protein family protein
Function (paralog2):Zinc-binding ribosomal protein family protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-0.42559932624755
Log2 mRNA fold difference:-0.13751264027242
Log2 TE fold difference:-0.28817153019452
Sequences
Protein sequence

MVNIPKTKNTYCKNKECKKHTLHKVTQYKKGKDSLAAQGKRRYDRKQSGYGGQTKPVFHK
KAKTTKKIVLRLQCQSCKHFSQRPIKRCKHFEIGGDKKGKGTSLF

MVNIPKTKNTYCKNKECKKHTLHKVTQYKKGKDSLAAQGKRRYDRKQSGYGGQTKPVFHK
KAKTTKKIVLRLQCQSCKHFSQRPIKRCKHFEIVLIESCAGKMVDEMIFSCVCCGGPGCC
GDRGEGPVGGGIDNEPVNVVVVVVEPGSQRRKMW

www.000webhost.com

Other information
Ka divergence:1KaKs divergence:0.997063
GC content 1 (%):43GC content 2 (%):47GC content divergence:0.044
Length 1 (bp):318Length 2 (bp):465Length divergence:0.188
MFE 1 (kcal):-84.02MFE 2 (kcal):-147.6MFE divergence0.275