Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G23540-AT4G14290
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):alpha/beta-Hydrolases superfamily protein
Function (paralog2):alpha/beta-Hydrolases superfamily protein

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:-2.2949507558851
Log2 mRNA fold difference:-2.3650294187212
Log2 TE fold difference:0.13843778880549
Sequences
Protein sequence

MDQLVNFIIRPPRAEYDPEHDLLEKKFMMKGRWYQRKDLEVKNSRGDVLQCSHYMPVERP
EGKPLPCVIYCHGNSGCRADGSEAAIVLLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD
LKAVVEFLRQDGNISLIGLWGRSMGAVTSLMYGVEDPSIAGMILDSPFSDLVDLMMELVD
TYKFRLPKFTVKFAIQFMRRAIQKKAKFDIMELNTIKVAKASFVPVLFGHALDDDFIRPH
HSDRIYEAYVGDKNIIKFPGDHNSPRPPFYFDSINIFFHNVLQPPEVVGPTFYDPLDDYF
ANGSWGTMNDTNIPQSSVQKSLAAGSISEAINEVRKKRPMSRTDVPSNVTLTSNGSPSET
KEKENPDGRGSSSSPDMISFDLSDGNQYPPHLRMALDDDQYVEYQMEDMADFPSNAEEEE
RMLMKAVMESLKDLEVQSQQKKEPPETRIHGGSAFLNAVQCISSREESTSTRANQSETDS
ASSPVTRSQDQLPSSSESNPPSETSSSLARTVTSSVPGSLSQKESETGDVPGTKATVTVE
RSSSAPGKVLDGLIRRWDLNFFKNNK

MEQLVNFVIRPPRAEYNPEHDLLEQEFLLKGRWYQRKDLEVKNIRGDILQCSHYMPVERP
EDRPLPCVIYCHGNSGCRADASEAAIVLLPSNITIFTLDFSGSGLSGGEHVTLGWNEKDD
LKAVVEYLRTDGNVSLIGLWGRSMGAVTSLMYGAEDPSIAAMVLDSPFSDLVDLMMELVD
TYKFRLPKFTIKFAIQYMRRAVQKKANFNITDLNTIKVAKSCFVPVLFGHAVDDDFIQPH
HSERIYEAYIGDKNIIKFDGDHNSPRPQFYFDSINIFFHNVLQPPEVVGPTFFDPVDDYF
AKGSWSTMQQLSSPPSSAQKSLAPGSTSDAINEVRLKRPMSRTEVPSNDPSNQSSSETKE
KESLEVSSSSSSDMISFDLSNGDPYPPHLAVALDDDQYVEFHVDELADFPSNAEEEERML
MEAVMKSLKDMEVEQTHQKKEPSRTNTETSEGNAAASTTEPELALSDTDSASGPTPCNHD
ARLSSVASVPSKTSDSLPGPVNGFVPGASPKTSQNKNDVIDLSARTKATVTVVGRSSTSG
NVLEGLLRRWDLNFFKSR

www.000webhost.com

Other information
Ka divergence:-0.0653346KaKs divergence:0.22055
GC content 1 (%):43GC content 2 (%):43GC content divergence:0
Length 1 (bp):1701Length 2 (bp):1677Length divergence:-0.007
MFE 1 (kcal):-492.39MFE 2 (kcal):-484.35MFE divergence-0.008