Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G23550-AT3G23560
Species:Arabidopsis
Duplication type:TD
Function (paralog1):MATE efflux family protein
Function (paralog2):MATE efflux family protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-0.97579539899906
Log2 mRNA fold difference:-0.53526319994899
Log2 TE fold difference:-0.35517411027955
Sequences
Protein sequence

MADPTSKDDHDGEGGRDKSSTFVQKLIDVEEAKTQIIYSLPMIFTNLFYYCIPLTSVMFA
SQLGQLELAGATLANSWATVTGFAFMTGLSGALETLCGQGFGAKSYRMLGIHLQSSCIVS
LVFTILITILWFFTESVFLLLRQDPSISKQAALYMKYLAPGLLAYGFLQNILRFCQTQCI
VTPLVLFSFLPLVINIGTTYALVHLAGLGFIGAPIATSISLWIAFVSLGFYVICSDKFKE
TWTGFSMESFHHVVLNLTLSIPSAAMVCLEYWAFEILVFLAGLMRNPEITTSLVAICVNT
ESISYMLTCGLSAATSTRVSNELGAGNVKGAKKATSVSVKLSLVLALGVVIAILVGHDAW
VGLFSNSHVIKEGFASLRFFLAASITLDSIQGVLSGVARGCGWQRLATVINLGTFYLIGM
PISVLCGFKLKLHAKGLWIGLICGMFCQSASLLLMTIFRKWTKLTAATV

MADPATSSPLLDDHVGGEDERGRRSRSSTLVQKVIDVEEAKAQMIYSLPMILTNVFYYCI
PITSVMFASHLGQLELAGATLANSWATVSGFAFMVGLSGSLETLCGQGFGAKRYRMLGVH
LQSSCIVSLVFSILITIFWFFTESIFGLLRQDPSISKQAALYMKYQAPGLLAYGFLQNIL
RFCQTQSIIAPLVIFSFVPLVINIATAYVLVYVAGLGFIGAPIATSISLWIAFLSLGTYV
MCSEKFKETWTGFSLESFRYIVINLTLSLPSAAMVCLEYWAFEILVFLAGVMPNPEINTS
LVAICVNTEAISYMLTYGLSAAASTRVSNELGAGNVKGAKKATSVSVKLSLVLALGVVIV
LLVGHDGWVGLFSDSYVIKEEFASLRFFLAASITLDSIQGVLSGVARGCGWQRLVTVINL
ATFYLIGMPIAAFCGFKLKFYAKGLWIGLICGIFCQSSSLLLMTIFRKWTKLNVATV

www.000webhost.com

Other information
Ka divergence:-0.236764KaKs divergence:0.221316
GC content 1 (%):42GC content 2 (%):42GC content divergence:0
Length 1 (bp):1410Length 2 (bp):1434Length divergence:0.008
MFE 1 (kcal):-407.97MFE 2 (kcal):-421.3MFE divergence0.016