Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G23570-AT3G23600
Species:Arabidopsis
Duplication type:TD
Function (paralog1):alpha/beta-Hydrolases superfamily protein
Function (paralog2):alpha/beta-Hydrolases superfamily protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:0.70630247625124
Log2 mRNA fold difference:0.82454575065768
Log2 TE fold difference:-0.19448246696773
Sequences
Protein sequence

MSGHQCTENPPDLDPTSGSGHVEKLGNLDTYVCGSTHSKLAVLLVPHVFGYETPNLRKLA
DKVAEAGFYAVVPDFFHGDPYNPENQDRPFPIWMKDHELEKGFEESKPIVEALKNKGITS
IGAAGFCWGAKVAVELAKEKLVDATVLLHPARVTVDDIKEVNLPIAVLGAEIDQVSPPEL
VRQFEDILASKPQVKSFVKIFPRCKHGWTVRYNENDPSEVEAAMEAHKDMLAWLIDYLK

MSGPQCCENPPTLNPVSGSGHVEKLGGLDAYVSGSAESKLCVLLISDIFGFEAPNLRALA
DKVAASGFYVVVPDYFGGDPYNPSNQDRPIPVWIKDHGCDKGFENTKPVLETIKNKGITA
IGAAGMCWGAKVVVELSKEELIQAAVLLHPSFVNVDDIKGGKAPIAILGAEIDQMSPPAL
LKQFEEILSSKPEVNSYVKIHPKVSHGWTVRYNIDEPEAVKAAEEAHKEMLDWFVTYIK

www.000webhost.com

Other information
Ka divergence:-0.368895KaKs divergence:-0.400642
GC content 1 (%):45GC content 2 (%):46GC content divergence:0.011
Length 1 (bp):720Length 2 (bp):720Length divergence:0
MFE 1 (kcal):-219MFE 2 (kcal):-226.1MFE divergence0.016