Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G23660-AT4G14160
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Sec23/Sec24 protein transport family protein
Function (paralog2):Sec23/Sec24 protein transport family protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:1.1904946529932
Log2 mRNA fold difference:0.72876612140259
Log2 TE fold difference:0.52919832342947
Sequences
Protein sequence

MAETANTDLEGIDGVRMTWNVWPHSKAEASKCVIPLAACISPIRRHADIPTLPYAPLRCR
TCSAALNAYAQVDFTAKLWICPFCYQRNHFPPHYHVISETNLPGELYPQYTTVEYTLPPP
VANGEGLVDPPVFVFVLDTCMIEEELDFAKSALKQAIGLLPENALVGFVSFGTQAHVHEL
GFSEMSKVFVFKGDKEISKDQILDQLGLGGSSRRGGSKGPQNGFPSSGLNRFLLPASECE
FTLNSLLDELQSDQWPVKPGHRSQRCTGVALSVAAGLLGACLPGTGARIVALIGGPCTEG
PGTIVSKDLSDPVRSHKDLDKDAAPYYKKAVKFYDSIAKQLVTQGHVLDLFASALDQVGV
AEMKVAVERTGGLVVLSESFGHSVFKDSFKRVFEDGDQALGLCFNGTLEICCSQDIKIQG
AIGPCSSLEKKGASVADTVIGEGNTSAWRLCGLDKTTCLTIFFDISSSGSNTPGAANPQF
YLQFLTSYQNPEGQTLLRVTTVCRQWIDSAVSSEELVQGFDQETAAVVMARLASLKMESE
VRHSRKLQFGVPRISNAYLFIQKRFKEGFDATRWLDRNLIRLCSKFGDYRKDDPASFTLN
PYFSLFPQFIFNLRRSQFVQVFNNSPDETAYFCMLLNRENISNATVMIQPSLTTYSFNSP
AEPALLDVASIAADRILLLDAYFSVVVFHGMTIAQWRNMGYHHQPEHQAFAELLQAPQED
SQMIVRERFPVPRLVVCDQHGSQARFLLAKLNPSATYNNANEMSTGSDVIFTDDVSLQVF
FEHLQKLVVQS

MAEMADKAKVEEMDWEGIDGVRMTWNLWPRTKVEASKCVIPLAASISPIRRHPLILDLPY
APLDCKTCKALLNAFARVDFAAMNWVCPFCYHRNHFPSHYHSISEINLPGELYPQYTTVE
YTLPPDPSRVPPPPVFVFVLDTCMIEEELGYAKSALKQAIGLLPENALVGFVSFGTQAHV
HELGFSEMSKVFVFKGNKEVTKDQILDQLGLGSSSRRAPTSGFSKGAQNGFQSSGVDRFL
LPASECEYTLDLLLDELQSDQWPVQPGHRPQRCTGVALSVAAGLLGACLPGTGARIVALV
GGPCTEGPGTIISKDLSDPVRSHKDLDKDAAPYYKKAVKFYDSIAKQLVAQGHVLDLFAS
ALDQVGVAEMKVAVESTGGLVVLSESFGHSVFKDSFKRMFEDGEHSLGLCFNGTLEINCS
KDIKIQGVIGPCSSLEKKGPNVADTVIGEGNTSAWKLCGLDKSTCLTVFFDLSSTGSTAP
GALNQQLYLQFITRYQNSEGKSLARVTTLTRQWVDTAVSTEVNLVQGFDQETAAVVMARL
TSLKMETEEGFDATRWLDRTLIRLCSKFGEYRKDDPTSFTLKPYLTLFPQFMFNLRRSQF
VQVFNNSPDETAYFRMLLNRENISNAIVMIQPSLTSYSFNSGPQAALLDVASIAADKILL
LDAYFSVVVFHGMTISQWRNMGYHHQPEHEAFAQLLQAPQEDSQMLVRERFPVPRLVVCD
QHGSQARFLLAKLNPSATYNNANEMSAGSDIIFTDDVSLQVFIEHLQKLAVQS

Other information
Ka divergence:0.139519KaKs divergence:0.356033
GC content 1 (%):44GC content 2 (%):45GC content divergence:0.011
Length 1 (bp):2376Length 2 (bp):2322Length divergence:-0.011
MFE 1 (kcal):-747.29MFE 2 (kcal):-738.74MFE divergence-0.006