Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G23670-AT4G14150
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):phragmoplast-associated kinesin-related protein, putative
Function (paralog2):phragmoplast-associated kinesin-related protein 1

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:0.75512847077949
Log2 mRNA fold difference:-0.86004694071705
Log2 TE fold difference:1.7429598457001
Sequences
Protein sequence

MKHFMMPRNAILRDIGESQSPNPSLTKSKSQRKIKSSKENAPPPDLNSLIPDHRSSPAKL
KSPLPPRPPSSNPLKRKLIAEATADNGVAIGVSDSGVKVIVRMKPPSKGEEEEMIVKKIS
NDALTINEQTFTFDSIADPESTQDEIFQLVGAPLVENCLAGFNSSVFAYGQTGSGKTYTM
WGPANGLLEEHLSGDQRGLTPRVFELLFARLSEEQAKHAERQLKYQCRCSFLEIYNEQIT
DLLDPSLKNLMIREDVKSGVYVENLTEEYVKNLKDLSKLLVKGLANRRTGATSVNAESSR
SHCVFTCVVESHCKSVADGLSSFKTSRINLVDLAGSERQKLTGAAGDRLKEAGNINRSLS
QLGNLINILAEISQTGKQRHIPYRDSRLTFLLQESLGGNAKLAMVCAVSPSQSCRSETFS
TLRFAQRAKAIQNKAIVNEVMQDDVNFLREVIRQLRDELQRVKDDKGNNPTNPNAAYTTS
WNARRSLSLLRSFGLGHPKSLPNGDDDGDTEMEIDEEAVERLCAQMGLSPPAEDNNQEMS
RVEKINSSLQTVVLKDESYNNSHLKSSEATDVNMEDACCQTENNGSETDNALTVAETMDD
GSSVQPDSITNSLHSCISDTNQGNSPSKAENIPSCQDLVIEADVSAIVSVADTSNNTEQV
SVNPVSPCLSVAPVSVSPVLIPPTESASPKIRNSRKSLRTTSMSTASQKDIERANQLTPE
VVEPSPAMSTEVLNLYSALSTKKSEAFPVPTRQLAASLHRGMKLLDSYRQSTALRRSTFR
LSYKALECKPSTVLSKADVGVQTYPQADEIAEDNSKEVLCSRCKCRAECDAQEISDTSNL
QLVPIDNSEGSEKSNFQVPKAVEKVLAGSIRREMAMEEFCTKQASEISQLNRLVQQYKHE
RECNAIIGQTREDKIVRLESLMDGVLSKDDFLDEEFASLMHEHKLLKDMYENHPEVLQTR
IELKRVQEELESFKNFYGDMGEREVLLEEIHDLKAQLQCYTDSSLTSARRRGSLLKLTYA
CDPNQAPQLNTIPESVDEGPEKTLEQERLRWTEAESNWISLAEELRTELDTNRLLMEKQK
RELDTEKRCAEELTEAMQMAMQGHARMIEQYADLEEKHIQLLARHRRIREGIDDVKKAAA
RAGVKGAESRFINALAAEISALKVQREKEVRYFRDENKSLQSQLRDTAEAVQAAGELLVR
FKEAEEGLTFAQKRAMDAEYEASEAYKKVDKLKRKYETEISTVNQQHNAEPQNPIESLQA
SCNDDAMAKYDEPSASDGDNQWREEFQPFYKKDEELSKLAEPSWFSGYDRCNI

MKKHFTLPRNAILRDGGEPHSPNPSISKSKPPRKLRSAKENAPPLDRNTSTPDHRSMRMK
NPLPPRPPPSNPLKRKLSAETATESGFSDSGVKVIVRMKPLNKGEEGDMIVEKMSKDSLT
VSGQTFTFDSIANPESTQEQMFQLVGAPLVENCLSGFNSSVFAYGQTGSGKTYTMWGPAN
GLLEEHLCGDQRGLTPRVFERLFARIKEEQVKHAERQLNYQCRCSLLEIYNEQITDLLDP
SQKNLMIREDVKSGVYVENLTEEYVKNLTDVSQLLIKGLGNRRTGATSVNTESSRSHCVF
TCVVESRCKNVADGLSSFKTSRINLVDLAGSERQKSTGAAGERLKEAGNINRSLSQLGNL
INILAEISQTGKPRHIPYRDSRLTFLLQESLGGNAKLAMVCAVSPSQSCRSETFSTLRFA
QRAKAIQNKAVVNEVMQDDVNFLRGVIHQLRDELQRMKNDGNNPTNPNVAYSTAWNARRS
LNLLRSFGLGHPRSLPHEDNDGDIEMEIDEAAVERLCVQVGLQSSLASEGINHDMNRVKS
IHSSDGQSIEKRLPEDSDVAMEDACCHTENHEPETVDNMRTETETGIRENQIKTHSQTLD
HESSFQPLSVKDALCSSLNKSEDVSSCPDLVPQDVTSANVLIADGVDDPEHLVNSASPSL
CIDPVGATPVLKSPTLSVSPTIRNSRKSLKTSELSTASQKDSEGENLVTEAADPSPATSK
KMNNCSSALSTQKSKVFPVRTERLASSLHKGIKLLESYCQSTAQRRSTYRFSFKAPDSEP
STSISKADAGVQTIPGADAISEENTKEFLCCKCKCREQFDAQQMGDMPNLQLVPVDNSEV
AEKSKNQVPKAVEKVLAGSIRREMALEEFCTKQASEITQLNRLVQQYKHERECNAIIGQT
REDKIIRLESLMDGVLSKEDFLDEEFASLLHEHKLLKDMYQNHPEVLKTKIELERTQEEV
ENFKNFYGDMGEREVLLEEIQDLKLQLQCYIDPSLKSALKTCTLLKLSYQAPPVNAIPES
QDESLEKTLEQERLCWTEAETKWISLSEELRTELEASKALINKQKHELEIEKRCGEELKE
AMQMAMEGHARMLEQYADLEEKHMQLLARHRRIQDGIDDVKKAAARAGVRGAESRFINAL
AAEISALKVEKEKERQYLRDENKSLQTQLRDTAEAIQAAGELLVRLKEAEEGLTVAQKRA
MDAEYEAAEAYRQIDKLKKKHENEINTLNQLVPQSHIHNECSTKCDQAVEPSVNASSEQQ
WRDEFEPLYKKETEFSNLAEPSWFSGYDRCNI

www.000webhost.com

Other information
Ka divergence:0.0385175KaKs divergence:-0.0274207
GC content 1 (%):43GC content 2 (%):43GC content divergence:0
Length 1 (bp):3942Length 2 (bp):3879Length divergence:-0.008
MFE 1 (kcal):-1194.22MFE 2 (kcal):-1162.59MFE divergence-0.013