Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G23730-AT4G14130
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):xyloglucan endotransglucosylase/hydrolase 16
Function (paralog2):xyloglucan endotransglucosylase/hydrolase 15

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:-1.7013709149427
Log2 mRNA fold difference:-2.0972954422049
Log2 TE fold difference:0.39597678652358
Sequences
Protein sequence

MGRILNRTVLMTLLVVTMAGTAFSGSFNEEFDLTWGEHRGKIFSGGKMLSLSLDRVSGSG
FKSKKEYLFGRIDMQLKLVAGNSAGTVTAYYLSSEGPTHDEIDFEFLGNETGKPYVLHTN
VFAQGKGNREQQFYLWFDPTKNFHTYSLVWRPQHIIFMVDNVPIRVFNNAEQLGVPFPKN
QPMKIYSSLWNADDWATRGGLVKTDWSKAPFTAYYRGFNAAACTVSSGSSFCDPKFKSSF
TNGESQVANELNAYGRRRLRWVQKYFMIYDYCSDLKRFPQGFPPECRKSRV

MGPSSSLTTIVATVLLVTLFGSAYASNFFDEFDLTWGDHRGKIFNGGNMLSLSLDQVSGS
GFKSKKEYLFGRIDMQLKLVAGNSAGTVTAYYLSSQGATHDEIDFEFLGNETGKPYVLHT
NVFAQGKGDREQQFYLWFDPTKNFHTYSIVWRPQHIIFLVDNLPIRVFNNAEKLGVPFPK
SQPMRIYSSLWNADDWATRGGLVKTDWSKAPFTAYYRGFNAAACTASSGCDPKFKSSFGD
GKLQVATELNAYGRRRLRWVQKYFMIYNYCSDLKRFPRGFPPECKKSRV

www.000webhost.com

Other information
Ka divergence:0.313018KaKs divergence:0.327785
GC content 1 (%):41GC content 2 (%):47GC content divergence:0.068
Length 1 (bp):876Length 2 (bp):870Length divergence:-0.003
MFE 1 (kcal):-234.1MFE 2 (kcal):-269.81MFE divergence0.071