Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G23760-AT4G14100
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):
Function (paralog2):transferases, transferring glycosyl groups

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:1.0749746951616
Log2 mRNA fold difference:-0.16105177621507
Log2 TE fold difference:1.1680515285234
Sequences
Protein sequence

MVLKPIHSFIVILLLVLSVGDKISAGTEPEKEPVPAVWPEQFHALMLMNKSGSLEIVDLW
YDWVNGRNFNIIQKQLGKLTYDLEWNNGTSFYYTLDASKTCRTVHFEVGILRPNWLDGAK
YMGQRHVNGFLCNVWEKVEFLWYYEDVVTKRPVQWIFYTGREAHVMTFEVGAVLEDEKWQ
APVYCFHNEKKEVQ

MAFRRPLIVIVIFIYITAGVKIAAADEPVPTPWPHQFHALMFMNYSGDLSMIDLWYDWTN
GRNFNIIQEQLGGITYDLEWNNGTSFFYTLDESKSCRSGQLEVGILRPNWLDGAKYLGQQ
NVSGFLCNVWEKVDFIWYYEDVETKRPVQWIFYTGREAHIMTYEVGAVLEDEKWQAPVYC
FNKEKKSLSTKGALSEFKGYKEKAAL

www.000webhost.com

Other information
Ka divergence:0.468244KaKs divergence:0.6423
GC content 1 (%):43GC content 2 (%):46GC content divergence:0.034
Length 1 (bp):585Length 2 (bp):621Length divergence:0.03
MFE 1 (kcal):-162.8MFE 2 (kcal):-192.7MFE divergence0.084