Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G23790-AT4G14070
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):AMP-dependent synthetase and ligase family protein
Function (paralog2):acyl-activating enzyme 15

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:-0.10988777828396
Log2 mRNA fold difference:0.92703778143199
Log2 TE fold difference:-1.0419649229531
Sequences
Protein sequence

MASTSLGASILVSHCSSAPEFQVSGMRLVFGYKAFGCRTSRRGFRVRCESKIQEKELRRC
SPFLERLSLPREAALSSNEWKSVPDIWRSSVEKYGDRVAVVDPYHDPPSTFTYRQLEQEI
LDFVEGLRVVGVKADEKIALFADNSCRWLVADQGIMATGAVNVVRGSRSSVEELLQIYCH
SESVALVVDNPEFFNRIAESFSYKAAPKFVILLWGEKSSLVTAGRHTPVYSYNEIKKFGQ
ERRAKFARSNDSGKYEYEYIDPDDIATIMYTSGTTGNPKGVMLTHQNLLHQIRNLSDFVP
AEAGERFLSMLPSWHAYERACEYFIFTCGVEQKYTSIRFLKDDLKRYQPHYLISVPLVYE
TLYSGIQKQISASSPARKFLALTLIKVSLAYTEMKRVYEGLCLTKNQKPPMYIVSLVDWL
WARVVAFFLWPLHMLAEKLVHRKIRSSIGITKAGVSGGGSLPMHVDKFFEAIGVNVQNGY
GLTETSPVVSARRLRCNVLGSVGHPIKDTEFKIVDHETGTVLPPGSKGIVKVRGPPVMKG
YYKNPLATKQVIDDDGWFNTGDMGWITPQHSTGRSRSCGGVIVLEGRAKDTIVLSTGENV
EPLEIEEAAMRSNLIQQIVVIGQDQRRLGAIVIPNKEAAEGAAKQKISPVDSEVNELSKE
TITSMVYEELRKWTSQCSFQVGPVLIVDEPFTIDNGLMTPTMKIRRDKVVDQYKNEIERL
YK

MQIRLKPDYSFFIASSSTMASTSSLGPSTLLSYGSPSRQFPDFGFRLISGHESVRIPSFR
RFRVHCESKEKEVKPSSPFLESSSFSGDAALRSSEWKAVPDIWRSSAEKYGDRVALVDPY
HDPPLKLTYKQLEQEILDFAEGLRVLGVKADEKIALFADNSCRWLVSDQGIMATGAVNVV
RGSRSSVEELLQIYRHSESVAIVVDNPEFFNRIAESFTSKASLRFLILLWGEKSSLVTQG
MQIPVYSYAEIINQGQESRAKLSASNDTRSYRNQFIDSDDTAAIMYTSGTTGNPKGVMLT
HRNLLHQIKHLSKYVPAQAGDKFLSMLPSWHAYERASEYFIFTCGVEQMYTSIRYLKDDL
KRYQPNYIVSVPLVYETLYSGIQKQISASSAGRKFLALTLIKVSMAYMEMKRIYEGMCLT
KEQKPPMYIVAFVDWLWARVIAALLWPLHMLAKKLIYKKIHSSIGISKAGISGGGSLPIH
VDKFFEAIGVILQNGYGLTETSPVVCARTLSCNVLGSAGHPMHGTEFKIVDPETNNVLPP
GSKGIIKVRGPQVMKGYYKNPSTTKQVLNESGWFNTGDTGWIAPHHSKGRSRHCGGVIVL
EGRAKDTIVLSTGENVEPLEIEEAAMRSRVIEQIVVIGQDRRRLGAIIIPNKEEAQRVDP
ETSKETLKSLVYQELRKWTSECSFQVGPVLIVDDPFTIDNGLMTPTMKIRRDMVVAKYKE
EIDQLYS

www.000webhost.com

Other information
Ka divergence:0.0384585KaKs divergence:-0.0111401
GC content 1 (%):43GC content 2 (%):42GC content divergence:-0.012
Length 1 (bp):2169Length 2 (bp):2184Length divergence:0.003
MFE 1 (kcal):-656.69MFE 2 (kcal):-648.51MFE divergence-0.006