Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G23800-AT4G14040
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):selenium-binding protein 3
Function (paralog2):selenium-binding protein 2

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:3.1974167530761
Log2 mRNA fold difference:3.1990288715872
Log2 TE fold difference:-0.053917480135536
Sequences
Protein sequence

MEAAMNNHDGDCCKSGPGYATPLLAMSGPREKLIYVAAIYTGTGQAKPDYLATVDVEPSS
STYSSVIHRLPMPYLEDELHHSGWNSCSSCYGDSSCERRYLILPSLLSGRIYVIDTKTNP
REPSLHKFVDPAEVLEKTGLAYPHQPHCLASGDVLVSCLGDEDGNAEGSGFLLLDSEFNI
KGRWEKDGNSPLYGYDFWYQPRHKTMISTSWGAPAAFTKGFDLKDVSDGLYGKHLHVYSW
PQGELKQILDLGDTGLLPLEVRFLHEPDKATGFAGCALSSTLVRFFKNDDETWSHEVAIS
VEPLKVENWILPEMPGLITDFLISLDDRFLYCSNWLHGDIRQYNIEDPKTPVLTGQIHVG
GLVQKGSLVLALGEEGKAFQFDVPKIKGQRLRGGPQMFQLSLDGKRLYVTNSLFSVWDRQ
FYPELVEKGSHMLQIDVDTDKGGLSINPNFFVDFGTEPDGPSLAHEMRYPGGDCTSDIWV

MATETVLATAVSNGKSKGCCKSGPGYATPLAAMAGPREKLIYVTALYSGTGRDKPDYLAT
VDVDPSSPTFSSVIHRLKMPYIGDELHHTGWNSCSSCHGDASADRRYLVLPGLISGRIYA
IDTKTDPKAPSLYKVVEPKEIAEKTGLAFPHTSHCLASGDMLVSCLGDKEGNAKGNGFLL
LDSDFNVKSRWDKPGHGPLFGYDFWYQPRFKTMISTSWGAPKAFSKGFNLQHVADGLYGS
HLHIYQWPEGEMKQIIDLGNTGLLPLEIRFLHDPSKDTGYVGSALSSNMIRFFKNSDDTW
SHEVVISVKPLKVENWILPEMPGLITDFLISLDDRFFYFVNWLHGDIRQYNIEDPKNPVL
TGQIWVGGLLQKGSPYKAVGEDGNTYQFDVPQIKGKSLRAGPQMIQLSLDGKRLYATNSL
FSAWDRQFYPEIMEKGSHIIQIDVDTDKGGLTLNPDFFVDFGDEPDGPALAHEMRYPGGD
CTSDIWI

www.000webhost.com

Other information
Ka divergence:0.0305976KaKs divergence:0.0965347
GC content 1 (%):47GC content 2 (%):46GC content divergence:-0.011
Length 1 (bp):1443Length 2 (bp):1464Length divergence:0.007
MFE 1 (kcal):-466.47MFE 2 (kcal):-477.01MFE divergence0.011