Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G23830-AT4G13850
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):glycine-rich RNA-binding protein 4
Function (paralog2):glycine-rich RNA-binding protein 2

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:2.9445539757101
Log2 mRNA fold difference:2.5463305108045
Log2 TE fold difference:0.28629632085215
Sequences
Protein sequence

MAFCNKLSGILRQGVSQSSNGPVTSMLGSLRYMSSKLFVGGLSWGTDDSSLKQAFTSFGE
VTEATVIADRETGRSRGFGFVSFSCEDSANNAIKEMDGKELNGRQIRVNLATERSSAPRS
SFGGGGGYGGGGGGGY

MAFCNKLGGLLRQNISSNGNVPVTSMLGSLRLMSTKLFIGGLSWGTDDASLRDAFAHFGD
VVDAKVIVDRETGRSRGFGFVNFNDEGAATAAISEMDGKELNGRHIRVNPANDRPSAPRA
YGGGGGYSGGGGGYGGGGGGYGGGGGGYGGGGDGGGGF

Other information
Ka divergence:-0.104392KaKs divergence:0.295967
GC content 1 (%):47GC content 2 (%):49GC content divergence:0.021
Length 1 (bp):411Length 2 (bp):477Length divergence:0.074
MFE 1 (kcal):-128.1MFE 2 (kcal):-149.53MFE divergence0.077