Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G23840-AT4G13840
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):HXXXD-type acyl-transferase family protein
Function (paralog2):HXXXD-type acyl-transferase family protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:2.448165174155
Log2 mRNA fold difference:2.035650738732
Log2 TE fold difference:0.35768188527954
Sequences
Protein sequence

MGLVQEEGSGPVHGFRLSTVSASLPSETGTTHEPTGLDLAMKLHYLKAVYIYSAGTARDL
TVMDVKAPLFSVFYQIPCIIGRFRRHESGRPYLKCNDCGTRFVESHCDLTVEEWLRVPDR
SVDESLVYHQPVGPDLAFSPLLYIQMTRFSCGGLALGLSWAHIMGDPFSLSHFFNLWAQA
FAGGKIYCPKTSVTERDFQNPTSTFKKPDSVKQVDLVGDLWVAPNNSKMTTFSFNLTVND
LKTHFPVNGDGEFEILTGIIWKCVATVRGESAPVTITVIRSDPKKLKPRAVRNGQMISSI
HVDFSVAEASLEEIVKSIGEAKDERVVIDEIVDDVSDFIVYGANLTFVDMSEVDFYEAKV
MGKSPESVYCNVQGIGDDGAVVVLPGVVEEERVVTVTLPVDEIEKVKWEMKKCGLITPLV

MGRSQEQGQGQGPVHSIRLSTVGATRPTETGTTHEPTGLDLAMKLHYLKAAYIYSAETAR
DLTVRHLKEAMFMLFDQIAWTTGRFSRRDSGRPYIKCNDCGTRFVEGQCNLTVEEWLSKP
DRSVDEFLVYHHPIGPELTFSPLIYVQMTRFKCGGLGLGLSWANIIGDAFSLFYAFNLWA
KAITGEKIYAPTTPSIGERRFQSPNPTVKDPVSIKRVEPVGDLWVTPNDKKLANYCFNLS
VADQISPHFPAKGDDSIPVFEILAGIIWKCIAKVRVEPKPVTVTIIKKDPNDLKLNAIRN
SQVISSVSVDFPVAEATVEELVKAMGEAKDERCGIEEIGESCDGNLDFVVYGAKLTFLDL
TGEDLYEAKVMGKSPESVYCNVEGIGEEGLVVVYAAAKSEERVVTVTLPEEEMERVKLEF
KKFGLIAP

Other information
Ka divergence:0.17344KaKs divergence:0.456853
GC content 1 (%):48GC content 2 (%):49GC content divergence:0.01
Length 1 (bp):1263Length 2 (bp):1287Length divergence:0.009
MFE 1 (kcal):-412.35MFE 2 (kcal):-430.42MFE divergence0.021