Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G23930-AT4G13540
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:1.9139995527202
Log2 mRNA fold difference:-1.1705095789394
Log2 TE fold difference:2.6384646928642
Sequences
Protein sequence

MGGCTSKQERRGVRSVKETSKDQSRGRRHLIKERDEREKVMFLQLKEAEREWRKERKKLR
EEVRRLRKKLEEREEAKTTTTEEREYWKWVVEEMCVERAVRDEAVEKWKQLYLAIKNELD
HLISHTTSSSGEAIMQRKLEEQEEEETEAKRVEVLRDEVRVKEETVETLEEQIVLMDRQK
YEKEREIDLLRQSLRILGSKKKKKTGSFASMNLLILKTKCVECT

MGGSTSKDERNSSKRRIKVKANEQRRRETRRELDEKERVILALKMAETEWRKERKRLREE
VKRLRQKMEEKEEGKAKQHEWEWVVEQMCLERAVREEAVERWKQLYFAIKNELDDLIHTT
YGEALRQKPQEEVAKAVQELRKEVKARGETIETLKGRINLMEKQQNGKEREIDLLRQSLR
ILGGSSGKNKALSSTTRNLTVFKTKFIGCK

www.000webhost.com

Other information
Ka divergence:0.049443KaKs divergence:0.258853
GC content 1 (%):40GC content 2 (%):44GC content divergence:0.048
Length 1 (bp):675Length 2 (bp):633Length divergence:-0.032
MFE 1 (kcal):-135.73MFE 2 (kcal):-124.35MFE divergence-0.044