Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G24020-AT4G13580
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Disease resistance-responsive (dirigent-like protein) family protein
Function (paralog2):Disease resistance-responsive (dirigent-like protein) family protein

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:-1.1227284054932
Log2 mRNA fold difference:-0.56944604043943
Log2 TE fold difference:-0.42012819462691
Sequences
Protein sequence

MMIKQSPFLLLTTILFTVAVFVAALDPAPEDPIFELYMHDLLGGSSPTARPITGLLGNIY
NGQVPFAKQIGFTPPENGIAIPNANGALPTVNGINGVPLGTGLSGTAYSGQNLNGIQTQL
GPDGLSLGFGTITVIDDILTSGPDLGSQPLGKAQGVYVASSADGSTQMMAFTAMLEGGEY
NDNLNFYGIYRIGSAMSHLSVTGGTGRFKNACGFAEVRPLIPSGQHEVDGAESLLRIIVH
LKY

MMKQSPFSLLTSIFLIAALFTATTALDPAPEDPIFELYMHDILGGSSPTARPITGLLGNI
YNGQVPFAKQIGFVPPQNGVAIPNANGAMPTVNGINGIPLGTGLSGTAFSGQNLNGIQTQ
LGPDGLSLGFGTITVIDDIITSGPDLGSQPLGKAQGVYVASSADGSTQMMAFTAMLEGGE
YNDNLNFYGIYRIGSAMSHLSVTGGTGRFKNACGFAEVRPLIPAGQHFVDGAEMLLRIIV
HLKY

www.000webhost.com

Other information
Ka divergence:-0.258225KaKs divergence:-0.464679
GC content 1 (%):47GC content 2 (%):46GC content divergence:-0.011
Length 1 (bp):732Length 2 (bp):735Length divergence:0.002
MFE 1 (kcal):-221.2MFE 2 (kcal):-227.24MFE divergence0.013