Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G24120-AT4G13640
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Homeodomain-like superfamily protein
Function (paralog2):Homeodomain-like superfamily protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:0.59564940900869
Log2 mRNA fold difference:1.1354660333796
Log2 TE fold difference:-0.26924875682075
Sequences
Protein sequence

MYSAIRSLPLDGGHVGGDYHGPLDGTNLPGDACLVLTTDPKPRLRWTTELHERFVDAVTQ
LGGPDKATPKTIMRTMGVKGLTLYHLKSHLQKFRLGRQAGKESTENSKDASCVGESQDTG
SSSTSSMRMAQQEQNEGYQVTEALRAQMEVQRRLHDQLEYGQVQRRLQLRIEAQGKYLQS
ILEKACKAFDEQAATFAGLEAAREELSELAIKVSNSSQGTSVPYFDATKMMMMPSLSELA
VAIDNKNNITTNCSVESSLTSITHGSSISAASMKKRQRGDNLGVGYESGWIMPSSTIG

MYSAIRSSLPLDGSLGDYSDGTNLPIDACLVLTTDPKPRLRWTSELHERFVDAVTQLGGP
DKATPKTIMRTMGVKGLTLYHLKSHLQKFRLGRQSCKESIDNSKDVSCVAESQDTGSSST
SSLRLAAQEQNESYQVTEALRAQMEVQRRLHEQLEYTQVQRRLQLRIEAQGKYLQSILEK
ACKAIEEQAVAFAGLEAAREELSELAIKASITNGCQGTTSTFDTTKMMIPSLSELAVAIE
HKNNCSAESSLTSSTVGSPVSAALMKKRQRGVFGNGDSVVVGHDAGWVMPSSSIG

www.000webhost.com

Other information
Ka divergence:0.129615KaKs divergence:0.00162426
GC content 1 (%):48GC content 2 (%):48GC content divergence:0
Length 1 (bp):897Length 2 (bp):888Length divergence:-0.005
MFE 1 (kcal):-287.29MFE 2 (kcal):-281MFE divergence-0.011