Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G24290-AT4G13510
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):ammonium transporter 1;5
Function (paralog2):ammonium transporter 1;1

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:6.3330538428634
Log2 mRNA fold difference:7.1988678759892
Log2 TE fold difference:-1.000911157848
Sequences
Protein sequence

MSGAITCSAADLSALLGPNATAAADYICGQLGSVNNKFTDAAYAIDNTYLLFSAYLVFAM
QLGFAMLCAGSVRAKNTMNIMLTNVLDAAAGGLFYYLFGYAFAFGESSDGFIGRHNFGLQ
NFPTLTSDYSFFLYQWAFAIAAAGITSGSIAERTKFVAYLIYSSFLTGFVYPVVSHWFWS
PDGWASPFRSEDRLFGTGAIDFAGSGVVHMVGGIAGLWGALIEGPRIGRFPDGGHAIALR
GHSASLVVLGTFLLWFGWYGFNPGSFTKILIPYNSGSNYGQWSGIGRTAVTTTLSGCTAA
LTTLFGKRLLSGHWNVTDVCNGLLGGFAAITAGCSVVDPWAAIVCGFVASLVLIGCNKLA
ELLKYDDPLEAAQLHGGCGAWGLIFVGLFAKEKYINEVYGASPGRHYGLFMGGGGKLLGA
QLVQIIVIVGWVSATMGTLFFILKKLNLLRISEQHEMRGMDLAGHGGFAYIYHDNDDDSI
GVPGSPVPRAPNPPAV

MSCSATDLAVLLGPNATAAANYICGQLGDVNNKFIDTAFAIDNTYLLFSAYLVFSMQLGF
AMLCAGSVRAKNTMNIMLTNVLDAAAGGLFYYLFGYAFAFGSPSNGFIGKHYFGLKDIPT
ASADYSNFLYQWAFAIAAAGITSGSIAERTQFVAYLIYSSFLTGFVYPVVSHWFWSVDGW
ASPFRTDGDLLFSTGAIDFAGSGVVHMVGGIAGLWGALIEGPRLGRFDNGGRAIALRGHS
ASLVVLGTFLLWFGWYGFNPGSFNKILVTYETGTYNGQWSAVGRTAVTTTLAGCTAALTT
LFGKRLLSGHWNVTDVCNGLLGGFAAITGGCSVVEPWAAIICGFVAALVLLGCNKLAEKL
KYDDPLEAAQLHGGCGAWGLIFTALFAQEKYLNQIYGNKPGRPHGLFMGGGGKLLGAQLI
QIIVITGWVSATMGTLFFILKKMKLLRISSEDEMAGMDMTRHGGFAYMYFDDDESHKAIQ
LRRVEPRSPSPSGANTTPTPV

www.000webhost.com

Other information
Ka divergence:-0.325206KaKs divergence:0.999922
GC content 1 (%):50GC content 2 (%):52GC content divergence:0.02
Length 1 (bp):1491Length 2 (bp):1506Length divergence:0.005
MFE 1 (kcal):-535.4MFE 2 (kcal):-521.86MFE divergence-0.013