Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G24480-AT4G13340
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Leucine-rich repeat (LRR) family protein
Function (paralog2):Leucine-rich repeat (LRR) family protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-0.26054007813317
Log2 mRNA fold difference:-0.69347200022867
Log2 TE fold difference:0.36701462243436
Sequences
Protein sequence

MKNNTTQSLLLLLLFFFFFFEISHSLSISSNAPLSDTEVRFIQRRQLLYYRDEFGDRGEN
VTVDPSLIFENPRLRSAYIALQAWKQAILSDPNNITVNWIGSNVCNYTGVFCSKALDNRK
IRTVAGIDLNHADIAGYLPEELGLLTDLALFHVNSNRFCGTVPHKFKQLKLLFELDLSNN
RFAGKFPTVVLHLPSLKFLDLRFNEFEGTVPKELFSKNLDAIFINHNRFRFELPENFGDS
PVSVIVLANNHFHGCIPTSLVEMKNLNEIIFMNNGLNSCLPADIGRLKNVTVFDVSFNEL
VGPLPESVGGMVEVEQLNVAHNLLSGKIPASICQLPKLENFTYSYNFFTGEAPVCLRLSE
FDDRRNCLPGRPAQRSSRQCSAFLSRPSVDCGSFGCGRSVVKPSPPIVALPPPPPPSPPL
PPPVYSPPPSPPVFSPPPSPPVYSPPPPPSIHYSSPPPPPVHHSSPPPPSPEFEGPLPPV
IGVSYASPPPPPFY

MKKTIQILLFFFFLINLTNALSISSDGGVLSDNEVRHIQRRQLLEFAERSVKITVDPSLN
FENPRLRNAYIALQAWKQAILSDPNNFTSNWIGSNVCNYTGVFCSPALDNRKIRTVAGID
LNHADIAGYLPEELGLLSDLALFHVNSNRFCGTVPHRFNRLKLLFELDLSNNRFAGKFPT
VVLQLPSLKFLDLRFNEFEGTVPKELFSKDLDAIFINHNRFRFELPENFGDSPVSVIVLA
NNRFHGCVPSSLVEMKNLNEIIFMNNGLNSCLPSDIGRLKNVTVFDVSFNELVGPLPESV
GEMVSVEQLNVAHNMLSGKIPASICQLPKLENFTYSYNFFTGEAPVCLRLPEFDDRRNCL
PGRPAQRSPGQCKAFLSRPPVNCGSFSCGRSVSPRPPVVTPLPPPSLPSPPPPAPIFSTP
PTLTSPPPPSPPPPVYSPPPPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPPPPPPPPPVY
SPPPPSPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPVYSSPPPPPSPAPTPVYCTRPPPP
PPHSPPPPQFSPPPPEPYYYSSPPPPHSSPPPHSPPPPHSPPPPIYPYLSPPPPPTPVSS
PPPTPVYSPPPPPPCIEPPPPPPCIEYSPPPPPPVVHYSSPPPPPVYYSSPPPPPVYYSS
PPPPPPVHYSSPPPPEVHYHSPPPSPVHYSSPPPPPSAPCEESPPPAPVVHHSPPPPMVH
HSPPPPVIHQSPPPPSPEYEGPLPPVIGVSYASPPPPPFY

www.000webhost.com

Other information
Ka divergence:-0.163998KaKs divergence:-0.282895
GC content 1 (%):45GC content 2 (%):51GC content divergence:0.063
Length 1 (bp):1485Length 2 (bp):2283Length divergence:0.212
MFE 1 (kcal):-437.69MFE 2 (kcal):-557.63MFE divergence0.121