Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G24870-AT3G24880
Species:Arabidopsis
Duplication type:TD
Function (paralog1):Helicase/SANT-associated, DNA binding protein
Function (paralog2):Helicase/SANT-associated, DNA binding protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-0.037638297276125
Log2 mRNA fold difference:-0.30814862325124
Log2 TE fold difference:0.18887050325982
Sequences
Protein sequence

MHGSVSGYLLVNAEVDSMGGVIDSGGGIGVKTSPRRTAIEKAQAELRQEYDVREERRREL
EFLEKGGNPLDFKFGIATSHSVQSTSLTDQQAEHFVNSEVKDSFALTASPHGDSVESSGR
PGVPTISEPNTADNLLLFDSENKSVEGERNLRHPNRQNRTSESERSSKAHTNQNTKETED
SAIFRPYARRNRSKISRDPARSSSTDLVQNRGGLATSISIRRGSVEGKGCIPEAANQKDM
HTTSVSCPVFANSNGNIVPKNRVSSNSLNTKVDGEPVVRESTAGSKTSLLKDEADISYSK
SSAYLPVGESGLAGEKAQLVSTGGSPKAATIAGQKNSSTQLNGLRDSTVEEESLTNRGAT
GTNGLESESSHANNVEVNVDNERDLYKVDKLDSDEISMQKTLRVEGLLDQTVGEMTKTKI
EDETGQSTTIISECIPECEMQMKSVKIENQSHRSTAEMQTKEKSSETEKRLQDGLVVLEN
DSKVGSILSENPSSTLCSGIPQASVDTSSCTVGNSLLSGTDIEALKHQPSSDAVMLDTVK
EDAILEEARIIQAKKKRIAELSCGTAPVEVREKSQWDFVLEEMAWLANDFAQERLWKMTA
ATQICHRVALTCQLRFEERNQHRKLKKIASVLSYAILQFWSSVEAEVPGELEETSLGIVK
ETCQESNCLNGIRCLAAGVKEYASRFLKYNNSSISYHSAALSTPDNMCDPEILDISMVDQ
LTEASLFYSVPSGAMEVYLKSIESHLTRCEKSGSSMQEEVDTSAYDTAGDIGYNVTAFDE
DEGETSTYYLPGAFESSRSFNISHKKRKNLMKSHSARSYDLGDDLPYVNNTGGSNSSSLI
VKRPDSNINAGSVPTRRVRTASRHRVVSPFGCATTGNLPVPSKTDASSGDTSSFQDEYSS
LHGGSAVQKGTEVESSVNFEKLLPYDMAETSGKPKKKKKTHQGSAYDQTWHLNPSVHVEQ
KDHWKKRPENNFDMNGLYGPHSAKKQKTTKQLVENNFDMAIPHTGSIPSPAASQMSNMSN
PNKSIKFIGGRDRGRKIKGLKISPGQHGSGNPWSLFEDQALVVLVHDMGPNWELISDAMN
STLKIKYIYRNPTECKDRHKILMDKTAGDGADSAEDSGNSQSYPSTLPGIPKGSARQLFQ
RLQGPMEEDTLKSHFEKICLIGKKLHYRKTQNDGRDPKQIVPVHNSQVMALSQVFPNNLN
GGVLTPLDVCDASTSGQDVFSLENPGLPMLNQGTPVLPTSGAHPSTPGSSGVVLSNNLPT
TSGLQSASVRDGRFNVPRGSLPLDEQHRLQQFNQTLSGRNLQQPSLSTPAAVSGSDRGHR
MVPGGNAMGVSGMNRNTPMSRPGFQGMASAAMPNTGNMHTSGMVGIPNTGNIHSGGGASQ
GNSMIRPREAVQHMMRMQAAQGNSPGIPAFSNLSSGFTNQTTPVQAYPGHLSQQHQMSPQ
SHVLGNSHHPHLQSPSQATGAQQEAFAIRQRQIHQRYLQQQQQQFPASGSMMPHVQQPQG
SSVSSSSQNSPQTQPPVSPQPLSMPPVSPSPNINAMAQQKPQKSQLALHGLGRSPQSGTS
GVNNQAGKQRQRQLQQSARQHPHQRQPTQGQQLNKQLKGMGRGNMIHQNITVDQSHLNGL
TMPQGNQATEKGEIAVSVRPDQQSSVGTTTSTDLQSKPFVSPLSSNHSQQLPKSFPGALS
PSPQQQMQLHSDNSIQGQSSPATPCNILSTSSLSIAPAVAPSNHQHLLIHQKQRNQVQST
AQRVVQHNHLGNSELSKKSQAECMPRVPQSVTNTTQTASMGTTKGMPQASNDLKNIKAVG
STAVPALEPPSCVASVQSTASKVVNNSNTDSAGNDPVSTPNQGLAQKHGIKGVTQRQQQS
LPSEEKRPKLPEKPTVQNQKHLASEEQPHLEEAQELSSSKPPDTKVE

MHGSVSGYLLVNAEVDSMGGVIDSGGGIGVKTSPRRTAIEKAQAELRQEYDVREERRREL
EFLEKGGNPLDFKFGIATSHSVQSTSLTDQQAEHFVNSEVKDSFALTASPHGDSVESSGR
PGVPTISEPNTADNLLLFDSENKSVEGERNLRHPNRQNRTSESERSSKAHTNQNTKETED
SAIFRPYARRNRSKISRDPARSSSTDLVQNRGGLATSISIRRGSVEGKGCIPEAANQKDM
HTTSVSCPVFANSNGNIVPKNRVSSNSLNTKVDGEPVVRESTAGSKTSLLKDEADISYSK
SSAYLPVGESGLAGEKAQLVSTGGSPKAATIAGQKNSSTQLNGLRDSTVEEESLTNRGAT
GTNGLESESSHANNVEVNVDNERDLYKVDKLDSDEISMQKTLRVEGLLDQTVGEMTKTKI
EDETGQSTTIISECIPECEMQMKSVKIENQSHRSTAEMQTKEKSSETEKRLQDGLVVLEN
DSKVGSILSENPSSTLCSGIPQASVDTSSCTVGNSLLSGTDIEALKHQPSSDAVMLDTVK
EDAILEEARIIQAKKKRIAELSCGTAPVEVREKSQWDFVLEEMAWLANDFAQERLWKMTA
AAQICHRVALTCQLRFEERNQHRKLKKIASVLSNAILQFWSSVEAEVPGELEETSLGIVK
ETCQESNCLNGRRCLAAGVKEYASRFLKYNNSSISYHSAAPSTPDNMCDPEILDISMVDQ
LTEASLFYSVPSGAMEVYLKSIESHLTRCEKSGSSMQEEVDTSAYDTAGDIGYNVTAFDE
DEGETSTYYLPGAFESSRSFNISHKKRKNLMKSHSARSYDLGDDLPYVNNTGGSNSSSLM
AKRPDSNINAGSVPTRRVRTASRQRVVSPFGCATTGNLPVPSKTDASSGDTSSFQDEYSS
LHGGSAVQKGTEVESSVNFEKLLPYDMAETSGRPKKKKKTHQGSAYDQTWHLDPSVHVEQ
KDHWKKRPENNFDMNGLYGPHSAKKQKTTKQLVENNFDMAIPHTGSIPSPAASQMSNMSN
PNKSIKFIGGRDRGRKIKGLKISPGQHGSGNPWSLFEDQALVVLVHDMGPNWELISDAMN
STLKIKCIYRNPTECKDRHKILMDKTAGDGADSAEDSGNSQSYPSTLPGIPKGSARQLFQ
RLQGPMEEDTLKSHFEKICLIGKKLHYRKTQSVIGVSVVSFVHGIQFSSCTGAGISQSLD
IPGLHVSKYSCKSWLGFPENDGRDSKQIVPVHNSQVMALSQVFPNNLNGGVLTPLDVCDA
STSGQDVFSLENPGLPMLNQGTPVLPTSGAHPSTPGSSGVVLSNNLPTTSGLQSASVRDG
RFNVPRGSLPLDEQHRLQQFNQTLSGRNLQQPSLSTPAAVSGSDRGHRMVPGGNAMGVSG
MNRNTPMSRPGFQGMASSAMPNTGSMLSSGMVEIPNTGNIHSGGGASQGNSMIRPREAVQ
HMMRMQAAQGNSPGIPAFSNLSSGFTNQTTPVQAYPGHLSQQHQMSPQSHVLGNSHHPHL
QSPSQATGAQQEAFAIRQRQIHQRYLQQQQQQQQFPASGSMMPHVQQPQGSSVSSSPQNS
PQTQPPVSPQPLSMPPVSPSPNINAMAQQKPQKSQLALHGLGRSPQSGTSGVNNQAGKQR
QRQLQQSARQHPHQRQPTQGQQLNKQLKGMGRGNMIHQNITVDQSHLNGLTMPQGNQATE
KGEIAVPVRPDQQSSVGTTTSTNLQSKPFVSPLSSNHSQQLPKSFPGALPPSPQQQMQLH
SDNSIQGQSSPATPCNILSTSSPSIAPAVAPSNHQHLLIHQKQRNQVQSTAQRVVQHNHL
GNSELSKKSQAERMPRVPQSVTNTTQTVSMGTTKGMPQASNDLKNIKAVGSTAVPALEPP
SCVASVQITASKVVNSSNTDSAGNDPVSTPNQGLAQKHGIKGVTQRQQQSLPSEEKRPKL
PEKPTVQNQKHLASEEQPHLEEAQELSSSKPPDTKVE

Other information
Ka divergence:-0.717418KaKs divergence:0.999448
GC content 1 (%):44GC content 2 (%):44GC content divergence:0
Length 1 (bp):5724Length 2 (bp):5874Length divergence:0.013
MFE 1 (kcal):-1742.84MFE 2 (kcal):-1797.81MFE divergence0.016