Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G25030-AT4G13100
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):RING/U-box superfamily protein
Function (paralog2):RING/U-box superfamily protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:0.42961322254806
Log2 mRNA fold difference:-0.36946044497331
Log2 TE fold difference:0.2516913416292
Sequences
Protein sequence

MIQMDGGDRLRVTLLDRMSTVESSRSCLTLEAILMADKNRTSPQILSPPPSRSQSNRSLV
EVMQREHRHSRDKTAWKSLREKLRLKRNGSVWISSNSIPSLDTPIPNRDNVSHQLGFLLS
NSGNVTEEASSVEGRIRLGAVLAEERALSAREEETPAEREVEPARMSLMELLEENEGQMS
FVSVDGEAEEEVAAVTAAEISCCVCMVRSKGAAFIPCGHTFCRLCSRELWVQRGNCPLCN
TTILEVLDLF

MTMPFALEICSAAIELRILVQIEGKLSAKVENGRSSVTLEDILMAETSSFRSLTTPTTPV
RNHSSSSLLDVMRRERRRDKTAWKSLRDKLRLKRTATGWISSNPIPTLDNHILTPDNDSH
RFNRLGFLLTNSETNRSSRDVSDAAEEAAEREGRLRLGTVLAAEREPPRMSLMELLEDND
GHMYELSARDEVEVEGRDGCDGGGEAVAVTGAAELGCCVCMVRSKGAAFIPCGHTFCRLC
SRELWVQRGNCPLCNTAILQVLDIF

www.000webhost.com

Other information
Ka divergence:-0.134975KaKs divergence:0.238416
GC content 1 (%):47GC content 2 (%):51GC content divergence:0.041
Length 1 (bp):753Length 2 (bp):798Length divergence:0.029
MFE 1 (kcal):-234.46MFE 2 (kcal):-279.35MFE divergence0.087