Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G25110-AT4G13050
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):fatA acyl-ACP thioesterase
Function (paralog2):Acyl-ACP thioesterase

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:0.82227880746455
Log2 mRNA fold difference:-0.77969155300592
Log2 TE fold difference:1.6332301477577
Sequences
Protein sequence

MLKLSCNVTDSKLQRSLLFFSHSYRSDPVNFIRRRIVSCSQTKKTGLVPLRAVVSADQGS
VVQGLATLADQLRLGSLTEDGLSYKEKFVVRSYEVGSNKTATVETIANLLQEVGCNHAQS
VGFSTDGFATTTTMRKLHLIWVTARMHIEIYKYPAWGDVVEIETWCQSEGRIGTRRDWIL
KDSVTGEVTGRATSKWVMMNQDTRRLQKVSDDVRDEYLVFCPQEPRLAFPEENNRSLKKI
PKLEDPAQYSMIGLKPRRADLDMNQHVNNVTYIGWVLESIPQEIVDTHELQVITLDYRRE
CQQDDVVDSLTTTTSEIGGTNGSATSGTQGHNDSQFLHLLRLSGDGQEINRGTTLWRKKP
SS

MLKLSCNVTDHIHNLFSNSRRIFVPVHRQTRPISCFQLKKEPLRAILSADHGNSSVRVAD
TVSGTSPADRLRFGRLMEDGFSYKEKFIVRSYEVGINKTATIETIANLLQEVACNHVQNV
GFSTDGFATTLTMRKLHLIWVTARMHIEIYKYPAWSDVVEIETWCQSEGRIGTRRDWILK
DCATGEVIGRATSKWVMMNQDTRRLQRVTDEVRDEYLVFCPPEPRLAFPEENNSSLKKIP
KLEDPAQYSMLGLKPRRADLDMNQHVNNVTYIGWVLESIPQEIIDTHELKVITLDYRREC
QQDDIVDSLTTSETPNEVVSKLTGTNGSTTSSKREHNESHFLHILRLSENGQEINRGRTQ
WRKKSSR

www.000webhost.com

Other information
Ka divergence:-0.0376123KaKs divergence:0.0523743
GC content 1 (%):45GC content 2 (%):43GC content divergence:-0.023
Length 1 (bp):1089Length 2 (bp):1104Length divergence:0.007
MFE 1 (kcal):-339.79MFE 2 (kcal):-313.71MFE divergence-0.04