Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G25290-AT4G12980
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Auxin-responsive family protein
Function (paralog2):Auxin-responsive family protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:2.7772533779201
Log2 mRNA fold difference:2.0325409533326
Log2 TE fold difference:0.57082281956861
Sequences
Protein sequence

MSSSSSVRISLSFIFLALLISPAVSQTCKSQTFSGDKTYPHCLDLPQLKAFLHYSYDASN
TTLAVVFSAPPAKPGGWIAWAINPKATGMVGSQTLVAYKDPGNGVAVVKTLNISSYSSLI
PSKLAFDVWDMKAEEAARDGGSLRIFARVKVPADLVAKGKVNQVWQVGPELGPGGMIGRH
AFDSANLASMSSLDLKGDNSGGTISGGDEVNAKIKNRNIHGILNAVSWGILFPIGAIIAR
YMRVFDSADPAWFYLHVSCQFSAYVIGVAGWATGLKLGNESEGIRFSAHRNIGIALFTLA
TIQMFAMLLRPKKDHKYRFYWNIYHHGVGYAILTLGIINVFKGLNILKPQDTYKTAYIAV
IAVLGGIALLLEAITWVVVLKRKSNNSMKPLRT

MDSSYLRISLSFLFWALLLSPAVSQSSSCSSQTFSGVKSYPHCLDLPDLKAILHYSYDAS
NTTLAVVFSAPPSKPGGWIAWAINPKSTGMAGSQALVASKDPSTGVASVTTLNIVSYSSL
VPSKLSFDVWDVKAEEAANDGGALRIFAKVKVPADLAASGKVNQVWQVGPGVSNGRIQAH
DFSGPNLNSVGSLDLTGTTPGVPVSGGGGAGNSRIHKRNIHGILNAVSWGLLFPIGAMIA
RYMRIFESADPAWFYLHVSCQFSAYVIGVAGWATGLKLGSESKGIQYNTHRNIGICLFSI
ATLQMFAMLLRPRKDHKFRFVWNIYHHGVGYSILILGIINVFKGLSILNPKHTYKTAYIA
VIGTLGGITLLLEVVTWVIVLKRKSAKSTKPLKA

Other information
Ka divergence:-0.0513584KaKs divergence:-0.0621062
GC content 1 (%):47GC content 2 (%):48GC content divergence:0.011
Length 1 (bp):1182Length 2 (bp):1185Length divergence:0.001
MFE 1 (kcal):-381.55MFE 2 (kcal):-386.21MFE divergence0.006