Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G26020-AT3G26030
Species:Arabidopsis
Duplication type:TD
Function (paralog1):Protein phosphatase 2A regulatory B subunit family protein
Function (paralog2):serine/threonine protein phosphatase 2A 55 kDa regulatory subunit B prime delta

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:1.0311016334928
Log2 mRNA fold difference:0.48349003999639
Log2 TE fold difference:0.59470730701632
Sequences
Protein sequence

MWKQILSKLPNKKSSKHEHRGREHGGHSSSSSHTSGASTSKSTDNGAAKSHAKNASPAGK
SAASDSGFKDGNLKSSGNNNNNNNNGVFTPYEALPSFKDVPNTEKQNLFIKKLNLCRVVF
DFTDPTKNIKEKDIKRQTLLELVDYVNSPNGKFSEVGIQEVVRMVSANIFRTLNPQPREN
KVIDALDLEEEEPSMDLAWPHLQLVYELFLRFVASPETDTKLAKRYIDQSFVLRLLDLFD
SEDPRERDCLKTILHRIYGKFMVHRPFIRKSINNIFYRFVFETEKHNGIAEFLEILGSII
NGFALPLKDEHKFVEKDCKLADTVIRGLLKYWPVTNSSKEVMFLNELEEVLEATQPPEFQ
RCMVPLFRQIARCLNSLHFQAISFRHTLTALLMRSRYSLPVISNEQMEELILRYGKYQCL
GLLYSALGVAERALFLWNNNHIENLIMQNRKVILPIIFPALERNAQKHWNQAVHSLTLNV
RKIFHDLDPELFKECLAKFKEDESKAAETEAKREATWKRLEELGVRKAS

MFKQILGKLPKKTSAKFWDNGESQTLDNNNNQGGGDEVLSQRTSSNGDTSLDCVSSFDVL
PRLRDVSISEKQELFLKKLRLCCLVFDFVAEPQQNFKEKEIKRQTLLEVVDYVISSGNGK
FPESVIQEATKMISANLFSNPHRQWKNKTPEALDLEEEEGSLNPSWPHLQIVYEFLLRIV
ASPNTDPKISKKYIDHTFVLKLLDLFDSEDPREREYLKTILHRIYGRFMVHRPFIRKTMN
NILYDFIFETGKHSGIAEFLEVLGSIINGFALPLKEEHKLFLTRVLIPLHKLKCLPNYHQ
QLSYCVIQFVEKDCKLADTVIRGMLKYWPVTNSAKEIMFLNELEEILEATQLTEFERCMV
PLSRQIAQCLSSSHFQVAERALYLWNNDHVTNLVRQNSRIILPIVFPALEKNGSSHWNQA
VKNLTENVLKVLSDTNPDLFEECLHKFQEDQQKAEDTKKKNGETWRQLEEIVASMAK

www.000webhost.com

Other information
Ka divergence:0.370202KaKs divergence:0.00743282
GC content 1 (%):41GC content 2 (%):40GC content divergence:-0.012
Length 1 (bp):1590Length 2 (bp):1434Length divergence:-0.052
MFE 1 (kcal):-434.04MFE 2 (kcal):-410.36MFE divergence-0.028