Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G26070-AT3G26080
Species:Arabidopsis
Duplication type:TD
Function (paralog1):Plastid-lipid associated protein PAP / fibrillin family protein
Function (paralog2):plastid-lipid associated protein PAP / fibrillin family protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-2.7170815649482
Log2 mRNA fold difference:-2.6714866476636
Log2 TE fold difference:-0.0039630569154913
Sequences
Protein sequence

MALPSCLKTGALMSPATGFNFSGSLMKSDSGFAVPTKLQSTRKGDRERLRVQAIFSFPPA
FLTRNGRAEKQKQLKQELLEAIEPLERGATASPDDQLRIDQLARKVEAVNPTKEPLKSDL
VNGKWELIYTTSASILQAKKPRFLRSITNYQSINVDTLKVQNMETWPFYNSVTGDIKPLN
SKKVAVKLQVFKILGFIPIKAPDSARGELEITYVDEELRLSRGDKGNLFILKMFDPTYRI
PL

MALPWCLKTGVLTSPAAGFNHPSDSGFAVPTKLLSIRKGDRERLRIQAVFSFPPRNGGAE
KRKQLKHELVEAIEPLERGATASPDDQLLIDQLARKVEAVNPTKEPLKSDLINGKWELIY
TTSAAILQAKKPRFLRSLTNYQCINMDTLKVQRMETWPFYNSVTGDLTPLNSKTVAVKLQ
VFKILGFIPVKAPDGTARGELEITYVDEELRISRGKGNLLFILKMFDPTYRIPL

www.000webhost.com

Other information
Ka divergence:0.522649KaKs divergence:0.85545
GC content 1 (%):43GC content 2 (%):45GC content divergence:0.023
Length 1 (bp):729Length 2 (bp):705Length divergence:-0.017
MFE 1 (kcal):-208.33MFE 2 (kcal):-211.33MFE divergence0.007