Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G26450-AT3G26460
Species:Arabidopsis
Duplication type:TD
Function (paralog1):Polyketide cyclase/dehydrase and lipid transport superfamily protein
Function (paralog2):Polyketide cyclase/dehydrase and lipid transport superfamily protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-0.57734126671419
Log2 mRNA fold difference:-0.47446857326779
Log2 TE fold difference:-0.12124788888146
Sequences
Protein sequence

MATSGTYVTQVPLKGTVEKHFKRYRNENYLFPDTIGHHIQSVTVHDGEWDTQGGIKIWNY
TLGDGKEEVFKERREIDDDNKIVKVVGLEGHVMEQFKVYEIDFQFIPNSEEDCVCKITMI
WEKRNDDFPEPSSYMQLLKSMVIDMEDHVLKA

MATSGTYVTEVPLKGTAEKHFQRWRNENHLFPDAVGHHIQGVSVHDGEWDTHGSIKIWNY
TLGDGKQEEFKERREMDDENNTMKVVGLEGHVMEQLKVYEIDFQFIPKSEEDCICKITMI
WEKRNDDFPEPSSYMQLLKSMVIDMEDHVLKA

Other information
Ka divergence:0.758646KaKs divergence:0.999635
GC content 1 (%):46GC content 2 (%):47GC content divergence:0.011
Length 1 (bp):459Length 2 (bp):459Length divergence:0
MFE 1 (kcal):-121.1MFE 2 (kcal):-115.9MFE divergence-0.022