Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G26890-AT5G41110
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-0.89227949087959
Log2 mRNA fold difference:-2.0868892814312
Log2 TE fold difference:1.04443421855
Sequences
Protein sequence

MGLPQTASSEQSQEALSTPSCSLSQSLPVYATSHDSDVLNSGSEEGICSSIAEFDRKTSL
EPLEFTDDSCRFRGTCVVTSSSAHGSTSYAAGKVSSSLTGARRIVGFASGETSSLDNKQT
SVAVDHSLSSTVGVAGVDIGGALVRKRVLSPLNTLFPVKFRGDLHDISCGNHQQITYSGQ
SNGFCNSVAQDHIKANTPSRLHLSTTPTTTSCWEWKNVSNSGRLSSMVFTDGPLLDSVDL
RQPVKGGEVCLYSPLYETSSTPNKPLPCDKEISVSPPLCLSPLGPKFSERVKAVRSCQTG
KILEDLRNISEEAELRVDRRLFDDAYAIRRAFSMERSTESAPASPCKRFIRSLSGRPIQR
SLVGSFEESLLTGRLSCGPTNQKIDGFLAVLSIAGGNISPKSQKLPFSVTSAGDDCLLLY
YASIDLAGGSKLNKFWGQKVKTSQMNSDAQSSKSQLRIPMKGRIQLVLSNPEKTPLHTFL
CNYDLTDMPAGTKTFLRQKVTLGSSNPTSEATQENTRKATSLEKENSKHGDKESCEGSDS
VDSVEGDVLHESGKICLKPSKECNGGSGALRYALHLRFLCPLPKKSSKKSEETESTGQKK
NLDSDGKRRFYLYNDLRVVFPQRHTDSDEGKLNVEYHYPENPRYFDITE

MGLPHTASNEQAHEALSAPSCSLSQSLPVNATSCDSDGINRGNEGSFRFSIGESDRKTAV
ESLEFRDDLWRFHDTRSVTSLPAHEPTYAMDKVNLSRTEVRRIVGFESNEVSSVSNEYTS
ITVNRTGGSNEVDIIGGSLVRKRVSSPLNKLFPEKFRGDSLDISHSNQPMTSAGLPKGFH
IPVGQDHKKANISGRLRLFTTSNCSEWGNDTSHTGKLSSTVFTDGPLLDSNDLQPSQDVH
CLYSPVHETFQVPNKPLPCHRNISVSPPLSLSPLGPRFSERMKALQGGLNGNIFEDDVCL
KNTGEEAELRTGHRSFDDTNGIQRAFSMDRAIESVPTSPCKRFSRSLSGRPIQRSLVGSF
EESLFSGRLSYGQANQKIDGFLAILSIAGGNISPKSQKLPFSVTSVGDDCFLLYYASIDL
SGGSLPSKLWGQKLKTNQNKSDAQTINKRLRIPMKGRIQLVLSNPEKTPLHTFLCNYDLT
DMPHGTKTFLRQKVTLASSVPTKAKKSANKGSEGSELVDELHSPNECGNKNCRETYRETG
QRCSKSGVLRYALHLKFICPLRKKASKLGQKKSLDAGDDGERRFYLYNELRVVFPQRHTD
SDEGKLNVEYHYPENPRYFDV

Other information
Ka divergence:0.117115KaKs divergence:0.372372
GC content 1 (%):43GC content 2 (%):42GC content divergence:-0.012
Length 1 (bp):1950Length 2 (bp):1866Length divergence:-0.022
MFE 1 (kcal):-587.93MFE 2 (kcal):-542.84MFE divergence-0.04