Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G26932-AT5G41070
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):dsRNA-binding protein 3
Function (paralog2):dsRNA-binding protein 5

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:0.41578820951679
Log2 mRNA fold difference:-0.11818613016112
Log2 TE fold difference:0.49870131192751
Sequences
Protein sequence

MYKNQLQELAQRSCFSLPSYTCTREGPDHAPRFKASVNFNGEIFESPTYCSTLRQAEHSA
AEVALSALSSKGPSKSLTARVLDETGIYKNLLQETAHRAGLDLPVYTSVRSGPGHIPTFS
CTVELAGMSFNGESAKTKKQAEKNAAIAAWFSLRKMPRLDPLRGEEKEQEIVARVLSRFR
PKEVKRREPNQSRRRTVIRTIRQNTTTTTTTTGDLLCEKLRSINLYTNEASSSSPPPQRF
WPSRTNLTQEQSKVKSLLEKCQEYAEKKQSLDDPKPEMRIKTSSPSPLSSSVERNCYSKL
LPFPSFVLNHQKLAPAVHIRSVIPVCSAPPPKPNPNPNSSPFITRELGNGSQEKKSLPN

MYKNQLQELAQRSCFNLPSYTCIREGPDHAPRFKASVNFNGEIFESPTYCSTLRQAEHAA
AEVSLNVLSSRVPSKSLTAKILDETGIYKNLLQETAHRAGLDLPMYTSVRSGSCHFPGFS
CTVELAGMTFTGESAKTKKQAEKNAAIAAWSSLKKMSSLDSQDEEKEQEAVARVLSRFKP
KEVRRRETTNQWRRRTSQQDSNKDLLIERLRWINLLTNQASSSSSTSTPNQHKNSSFISL
IPPPPPPKSSKILPFIQQYKDRSSQEAKTETATEMINSKAKVNETSTRLSKQMPFSDMNR
YNFVGGCSVNPYSLAPAVQMRSVIPVFAAPPPKPNPNLNPSSLSSSVNEFTSSNNSCSVL
NTPGLGGQEKKNLTREMIKLGSESRILDQTHDS

www.000webhost.com

Other information
Ka divergence:0.0442306KaKs divergence:-0.1442
GC content 1 (%):41GC content 2 (%):41GC content divergence:0
Length 1 (bp):1080Length 2 (bp):1182Length divergence:0.045
MFE 1 (kcal):-259.36MFE 2 (kcal):-286.55MFE divergence0.05