Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G26960-AT5G41050
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Pollen Ole e 1 allergen and extensin family protein
Function (paralog2):Pollen Ole e 1 allergen and extensin family protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-0.70658722703427
Log2 mRNA fold difference:0.41026354342821
Log2 TE fold difference:-1.3736128624746
Sequences
Protein sequence

MTKKSLTMFLFILLQFLLVNSLSSKHSSPKPKPDAEITIMGFVYCDVCSKNSFSKHSYFM
SGVEVRIVCRFKAASSTTTETITFSANRTTNEFGLYKVAISSLDCADVDSLASSCQASLI
GRKNFSDSSCNIPGYRTTTDQVLFKSQQSNSCVYGFNALNFRPFKRDLALCGKK

MKQKLIMLLLLLQLLSLNSLSLKHSSAKPNGKITVMGLVYCDVCSNNSFSNHSYFIPGVE
VRIICRFNSASSRTREMITFSANRTTNELGLYKLDITSLEGVACAAEAKKDSLMASCQAS
LIGRSKDSCNVPGFRTTTEQVVFKSKISNLCVYGFTALNFRPLEKNLHLCGK

Other information
Ka divergence:0.0443805KaKs divergence:-0.0622024
GC content 1 (%):40GC content 2 (%):42GC content divergence:0.024
Length 1 (bp):525Length 2 (bp):519Length divergence:-0.006
MFE 1 (kcal):-137MFE 2 (kcal):-140.35MFE divergence0.012