Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G27230-AT5G40830
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):S-adenosyl-L-methionine-dependent methyltransferases superfamily protein
Function (paralog2):S-adenosyl-L-methionine-dependent methyltransferases superfamily protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-0.53040376559428
Log2 mRNA fold difference:-0.69281209265018
Log2 TE fold difference:0.16418861665768
Sequences
Protein sequence

MGSVSLKIGDGTARFRRTSICSSAVNLLMLFSVVTTNLFALYAFSSHSQANSPLLHSSNN
ISLVSQHLSLILREIDSSQRKLAQMEKQMLGYESIDISRPNIVPELKLFLQRHQLPLGKD
SRTGITEMVSSVGHSCGKSTDLLSQYMSYKVFDRCPDDWSLGQKLILRACEPLPRRRCLA
KTVQKQDLSKSPDSLWRSVSNKSVNWSGLGCKSFDCLKGKKLSKECVGCFDLGVEKDRFV
KVKGKNDFLIDDVLGLGSGKIRIGFDISGGSGTFAARMAEKNVTVITNTLNNGAPFSEFI
AARGLFPLFLSLDHRFPFLDNVFDLIHASSGLDVEGKAEKLEFLMFDLDRVLKPRGLFWL
DNFYCANDEKKKELTRMIERFGYKKLKWVIGEKADAQVYLSAVLQKPVRA

MGSVSLKIGDGTARFKRSTLFSSAINLLMLFSIVTTNLFALYAFSSRSQSHTPHPLHSNN
VSLVSQHLSLILREIDSSHHTLTQMEKQIIGYESLDLSQQEVPQELKLFLQQHQLPLGKD
SRTGITQMVASVGHSCEMSLDLLSQYMSYNVFEKCPDDWSLAQKLILRACEPLPRRRCLA
KTVHKPGLALFPDSLWRPVGNSSVNWSGLGCKSFECLKGKKLSRDCVGCFDLATSHEKDR
FVKVNGKTDFLIDDVLDLGDGKIRIGFDISSGSGTFAARMAEKNVNIISNTLNIDAPFSE
FIAARGIFPLFMSLDQRLPFYDNVFDLIHASNGLDLAVSNKPEKLEFLMFDLDRILKPGG
LFWLDNFYCGNDEKKRVLTRLIERFGYKKLKWVVGEKTDAEVFLSAVLQKPARI

Other information
Ka divergence:0.271517KaKs divergence:-0.438361
GC content 1 (%):43GC content 2 (%):42GC content divergence:-0.012
Length 1 (bp):1233Length 2 (bp):1245Length divergence:0.005
MFE 1 (kcal):-377.59MFE 2 (kcal):-346.92MFE divergence-0.042