Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G27240-AT5G40810
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Cytochrome C1 family
Function (paralog2):Cytochrome C1 family

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-0.075747921674497
Log2 mRNA fold difference:-0.0063669409421815
Log2 TE fold difference:-0.074664587664424
Sequences
Protein sequence

MVGGGVIQQILRRKLHSQSLATPVLSWFSSKKAHEDAGSSGVRALALLGAGVTGLLSFST
VASADEAEHGLESPEYPWPHDGILSSYDHASIRRGHQVYQQVCASCHSMSLISYRDLVGV
AYTEEEAKAMAAEIEVVDGPNDEGEMFTRPGKLSDRFPQPYANESAARFANGGAYPPDLS
LITKARHNGPNYVFALLTGYRDPPAGISIREGLHYNPYFPGGAIAMPKMLNDEAVEYEDG
VPATEAQMGKDIVSFLAWAAEPEMEERKLMGFKWIFLLSLALLQAAYYRRLKWSVLKSRK
LVLDVVN

MVGGGVIRQLLRRKLHSQSVATPVLSWLSSKKANEDAGSAGLRAFALMGAGITGLLSFST
VASADEAEHGLECPNYPWPHEGILSSYDHASIRRGHQVYQQVCASCHSMSLISYRDLVGV
AYTEEEAKAMAAEIEVVDGPNDEGEMFTRPGKLSDRLPEPYSNESAARFANGGAYPPDLS
LVTKARHNGQNYVFALLTGYRDPPAGISIREGLHYNPYFPGGAIAMPKMLNDEAVEYEDG
TPATEAQMGKDVVSFLSWAAEPEMEERKLMGFKWIFLLSLALLQAAYYRRLKWSVLKSRK
LVLDVVN

www.000webhost.com

Other information
Ka divergence:-0.204605KaKs divergence:-0.463378
GC content 1 (%):47GC content 2 (%):46GC content divergence:-0.011
Length 1 (bp):924Length 2 (bp):924Length divergence:0
MFE 1 (kcal):-312.31MFE 2 (kcal):-308.18MFE divergence-0.007