Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G27250-AT5G40800
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-1.2071081193942
Log2 mRNA fold difference:0.0092237001849721
Log2 TE fold difference:-0.7913772209195
Sequences
Protein sequence

MDQDDWLGTLRYAGKAQDKVSVDALMLRYRPIAPKPTTGQPCGVADNNNNSSYGMSKRTK
RKYVRVSKNNKGTCRGKSRSDLSDDREQTDVVTLQLLPEKSDISGEYSPLDQDSLDPSVK
SIIGEETQETNTWGMFNGSVTAEMETWVTVESVTSVCEGSLSSHAVGITDVEIVDNLGKD
TCPAFVSDGSNRVVWVNEAYRRNVSGDDSTASVSPEVVVWLVAEEATAAMHCNYQAFTCR
VRMQYTWKETKYTKTVPCDVWKMEFGGFAWRLDTTAALTLWL

MDQDHELWRTLRCAGKAQDKTSVDTLMLKYRPIAPKPTTTGQPLVGDTSSTRRTKRKYVR
VSKNNKATCRSKTNGFRSSSTDPENGREDIVTLQLLPERSTPLSLDHNNLDPTVETINGD
ETCNTDTWLKFNGGDDALQQVPVETWVTVESVNSGLVSHAVGLTDEELTYALDKDTCPGF
ISDGSNRVVMVNEAYRRIVTGDGGFGREVIVWLVVDQTATFCDYRTFTCKVRMEYTWRET
KYTKTLPCDVWKMEFGGFAWRLDTTAALTLWL

www.000webhost.com

Other information
Ka divergence:0.0932224KaKs divergence:-0.187245
GC content 1 (%):50GC content 2 (%):48GC content divergence:-0.02
Length 1 (bp):849Length 2 (bp):819Length divergence:-0.018
MFE 1 (kcal):-313MFE 2 (kcal):-268.34MFE divergence-0.077