Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G27280-AT5G40770
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):prohibitin 4
Function (paralog2):prohibitin 3

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:1.6137486316873
Log2 mRNA fold difference:1.4429733119477
Log2 TE fold difference:0.16528661650586
Sequences
Protein sequence

MGSQQVAISFLTNLAKAAFGLGVAATALNSSLYTVDGGERAVLFDRFRGVLDQTVGEGTH
FLIPYLQTPHIYDIRTKPHTFSSKSGTKDLQMVNLTLRVLFRPEVSRLPYIFQTLGLEYD
EKVLPSIGNEVLKAVVANFNADQLLTERPQVSALVRDALIKRAREFNIELDDIAITHLSY
GAEFSRAVEAKQVAQQEAERSKFVVMKADQERRAAVIRAEGESEAAQLISDATAKAGMGL
IELRRIEASREVAATLARSPNVAYLPGGQSMLFNLNPGR

MGSQQAAVSFLSNLAKAAFGLGTAATVLNTSLFTVDGGERAVIFDRFRGVMDQTVGEGTH
FLIPILQRPHIFDIRTKPHTFSSISGTKDLQMVNLTLRVLSRPEVSRLPYIFQTLGLEYD
EKVLPSIGNEVLKAVVAQFNADQLLTERPHVSALVRESLITRAKDFNIVLDDVAITHLSY
GVEFSRAVEQKQVAQQEAERSKFVVMKADQERRAAVIRAEGESEAAQLISDATAKAGMGL
IELRRIEASREIASTLARSPNVAYLPGGQSMLFALNR

www.000webhost.com

Other information
Ka divergence:-0.56654KaKs divergence:-0.378981
GC content 1 (%):48GC content 2 (%):49GC content divergence:0.01
Length 1 (bp):840Length 2 (bp):834Length divergence:-0.004
MFE 1 (kcal):-275.19MFE 2 (kcal):-283.94MFE divergence0.016