Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G27380-AT5G40650
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):succinate dehydrogenase 2-1
Function (paralog2):succinate dehydrogenase 2-2

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-1.1793902819589
Log2 mRNA fold difference:-0.79477527017942
Log2 TE fold difference:-0.29569259679006
Sequences
Protein sequence

MASGLIGRLVGTKPSKLATAARLIPARWTSTGAEAETKASSGGGRGSNLKTFQIYRWNPD
NPGKPELQNYQIDLKDCGPMVLDALIKIKNEMDPSLTFRRSCREGICGSCAMNIDGCNGL
ACLTKIQDEASETTITPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKTPASVPAKEILQ
SKKDRAKLDGMYECILCACCSTSCPSYWWNPESYLGPAALLHANRWISDSRDEYTKERLE
AIDDEFKLYRCHTILNCARACPKGLNPGKQITHIKQLQR

MAFGLIGRVVGTKSSRLSTAARLIPARWTSTGSEAQSKASTGGGGASLKTFQIYRWNPDN
PGKPELQDYKIDLKDCGPMVLDALIKIKNEMDPSLTFRRSCREGICGSCAMNIDGCNGLA
CLTKIESGSKETTITPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPASVPGKEILQS
KKDRAKLDGMYECILCACCSTSCPSYWWNPESYLGPAALLHANRWISDSRDEYTKERLEA
IDDEFKLYRCHTILNCARACPKGLNPGKQITHIKQLQKSG

www.000webhost.com

Other information
Ka divergence:-0.0407814KaKs divergence:-0.480156
GC content 1 (%):44GC content 2 (%):44GC content divergence:0
Length 1 (bp):840Length 2 (bp):843Length divergence:0.002
MFE 1 (kcal):-259.5MFE 2 (kcal):-256.94MFE divergence-0.005