Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G27390-AT5G40640
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-2.2124239493851
Log2 mRNA fold difference:-1.550474261478
Log2 TE fold difference:-0.49534608707833
Sequences
Protein sequence

MEPPIGFRASLFQFLLFLPYFIGLLFLGFIKGIVLCPLVCLVVTIGNSAVILSLLPVHIV
WTFYSIVSAKQVGPILKIFLCLCLPAAIILWPIVGILGSVLGGALYGFFSPIFATFDAVG
EGKPYQFFHCFYDGTWSTMQRSFTVVRDFKDVCFHSYFSLMDELKQSCPDRKYYEIRLLQ
LPGALVVSVLGILVDPPVISLVAICKSPYMLFKGWHRLFHDLIGREGPFLETMCVPIAGL
AILLWPLAVTGAVIGSVISSIFLGAYAGVVSYQESSFYYGLCYIVASVSIYDEYSTDILD
LPEGSCFPRPKYRRKDEEPTPFSGPVPRLGSVKNASSMRGGSVRVPMIDIKPLDLLNELF
VECRRYGEVLATKGLINSKDIEEARSSKGSQVISVGLPAYGLLYEILRSVKANSSGLLLS
DGVTEITTMNRPKDVFFDWFLNPFLILKEQMKATNLSEEEEEYLGRLVLLFGDPERLKSS
NAISASPPLTERKRAELDAFARRMQGLTKTVSRYPTFRRHFVALVKKLSEDLDLKDNNSA
KDESITEPPAPVKIISRIFSQRSFRRKGSVNGSDQESQKGVSRNVDIV

MEPPTGILASLWQFILFIPYFTGLLLLGVIKGIVLCPLICLTVAIGNSAIILGLLPVHAI
WTLYSIASAKQLGPILKIFLCLCVPLGVILWLVVSILGSVLGGAIYGFLSPIFATFDAVG
EGKSNPFFHCFYDGTWSTVQGSFTVVCDFKDVCFHSYFSFMDDLRTSTANRHYYEIRLLQ
IPGAVIVAVLGILVDFPVISLLALCKSPYMLFKGWHRLFHDLIGREGPFLETMCVPIAGL
VILLWPLAVVGAVLGSVVSSVFLGAYGGVVSYQESSFFFGLCYVVASVSIYDEYSNDVLD
MPEGSCFPRPIYRRNEEGASTAFSGGLSRPNSFKTTPSRGGSNKGPMIDLKPLDLLEALF
VECRRHGEIMVTKGIINSKDIEEAKSSKGSQVISFGLPAYSLLHELLRSIKSNSTGLLLG
DGVTEITTRNRPKDAFFDWFLNPFLILKDQIEAANLSEEEEEYLGKLVLLFGDSERLKSS
IVESESPPLTELRKAELDAFARRLQGLTKSVSRYPTFRRHFVELVKKLSNDLDNKHNRFE
GGSRSVPRPGKTVSRIFSQKSFKKKTSSNGSDQDSPNRGLRDIDIV

www.000webhost.com

Other information
Ka divergence:-0.258638KaKs divergence:-0.388702
GC content 1 (%):43GC content 2 (%):41GC content divergence:-0.024
Length 1 (bp):1767Length 2 (bp):1761Length divergence:-0.002
MFE 1 (kcal):-525.33MFE 2 (kcal):-517.67MFE divergence-0.007