Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G27420-AT5G40600
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-1.3266769031675
Log2 mRNA fold difference:-0.13272221250625
Log2 TE fold difference:-1.1488621117186
Sequences
Protein sequence

MPKRTAEACPSSEIQRSRGDTFGSYRSQVAELLSLGERISHHDQQEANERHSESVIGAGM
SNVEKDNLNVLLRQCVRNLSPEVDEMQECVRSLYLISQLGNKCQSSSPSDFVPEETGGAR
EDDIQLLLRSDSDMVKNITSQYSNVLLSKLDNMQQELERLLDDVVATCRPMTRGEIRELQ
KSIKELPERNLNRVAEIVGNHCIASGRDFNDKVIVNLDQADKVMLWRLHFYVGAVKRPRS
SLPS

MTIPVPLESLFPLLHRSVNCSFLPGGAILISGDFSDFIVEQDLFDNVGFEIARLVARLVF
FSLSGAEICFCYIPESAMSKRAAEEMTPSLESNRTGPDFFGYYRAQVEELLSQEEKIPHH
NHVDAKKSSAEIIGAELSDVKQEKLNALLRQCVLNSIPEVDEMQSRVDSMYLMSQLSNKK
RSTLPTNAESVIPEDPRCKEVEDDLRLLMKSDPSLVKEIVGKHSSDLLARLNERQQHLEK
LLDNVVTTCRPMSRGEKRDLQKSIKELPAKNLERVAGIIKNHYVALGKEMPDDVFVINME
EEDKVLLWRLHYFVVAVQSARKLAS

www.000webhost.com

Other information
Ka divergence:-0.229702KaKs divergence:0.0866938
GC content 1 (%):44GC content 2 (%):42GC content divergence:-0.023
Length 1 (bp):735Length 2 (bp):978Length divergence:0.142
MFE 1 (kcal):-219.2MFE 2 (kcal):-283.06MFE divergence0.127