Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G27430-AT5G40580
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein
Function (paralog2):20S proteasome beta subunit PBB2

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-1.1449275128149
Log2 mRNA fold difference:-0.42700002194806
Log2 TE fold difference:-0.72974047148374
Sequences
Protein sequence

MSQSTVDVPPKGGFSFDLCKRNDMLTQKGLKAPSFLKTGTTIVGLIFKDGVILGADTRAT
EGPIVADKNCEKIHYMAPNIYCCGAGTAADTEAVTDMVSSQLRLHRYQTGRDSRVITALT
LLKKHLFSYQGHVSAALVLGGVDITGPHLHTIYPHGSTDTLPFATMGSGSLAAMSVFEAK
YKEGLTRDEGIKLVAESICSGIFNDLGSGSNVDICVITKGNKEYLRNYMEPNPRTYVSSK
GYSFTKKTEVLLTKITPLLERVEITEVGEAMEE

MSQSSVDIPPKGGFSFDLCKRNDMLTQKGLKAPSFLKTGTTIVGLIFKDGVILGADTRAT
EGPIVADKNCEKIHYMAPNIYCCGAGTAADTEAVTDMVSSQLRLHRYQTGRDSRVVTALT
LLKKHLFSYQGHVSAALVLGGVDITGPHLHTIYPHGSTDTLPFATMGSGSLAAMSVFEAK
YKEGLTRDEGIKLVAEAICSGIFNDLGSGSNVDICVITKGHKEYLRNYMEPNPRTYVSSK
GYSFTKKTEVLLTKITPLLERVEIVEVAGEAMEE

Other information
Ka divergence:-1KaKs divergence:-0.811765
GC content 1 (%):45GC content 2 (%):45GC content divergence:0
Length 1 (bp):822Length 2 (bp):825Length divergence:0.002
MFE 1 (kcal):-250.5MFE 2 (kcal):-268MFE divergence0.034